Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6QL36

Protein Details
Accession A0A2Z6QL36    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-33MVVIGNKRNKKARNRLPQKKRRQWNVREKLMIVHydrophilic
NLS Segment(s)
PositionSequence
7-23KRNKKARNRLPQKKRRQ
Subcellular Location(s) mito_nucl 11.833, mito 11, nucl 10.5, cyto_nucl 8.666, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018586  Brinker_DNA-bd  
IPR009057  Homeobox-like_sf  
IPR006600  HTH_CenpB_DNA-bd_dom  
IPR010921  Trp_repressor/repl_initiator  
Gene Ontology GO:0043565  F:sequence-specific DNA binding  
Pfam View protein in Pfam  
PF09607  BrkDBD  
PF03221  HTH_Tnp_Tc5  
PROSITE View protein in PROSITE  
PS51253  HTH_CENPB  
Amino Acid Sequences MVVIGNKRNKKARNRLPQKKRRQWNVREKLMIVHYFENNNRNVRGTAKKFNIQPKQLRDWSNKKGILLTTASHVAKLHSGKPAKYPKLEDDLFVWISEKRANGNAITQKIITNKAISLSKSPEFLANNLGIAGFKFSSKWLDGFLGRYDLSERRRKW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.89
3 0.92
4 0.94
5 0.95
6 0.94
7 0.94
8 0.94
9 0.93
10 0.93
11 0.93
12 0.92
13 0.9
14 0.83
15 0.73
16 0.67
17 0.62
18 0.54
19 0.45
20 0.38
21 0.31
22 0.32
23 0.34
24 0.34
25 0.32
26 0.32
27 0.3
28 0.29
29 0.28
30 0.29
31 0.35
32 0.36
33 0.41
34 0.43
35 0.47
36 0.51
37 0.59
38 0.62
39 0.61
40 0.63
41 0.6
42 0.63
43 0.64
44 0.64
45 0.63
46 0.62
47 0.61
48 0.61
49 0.56
50 0.49
51 0.45
52 0.39
53 0.34
54 0.27
55 0.21
56 0.14
57 0.17
58 0.17
59 0.15
60 0.15
61 0.12
62 0.14
63 0.15
64 0.15
65 0.17
66 0.19
67 0.2
68 0.28
69 0.36
70 0.36
71 0.37
72 0.38
73 0.35
74 0.4
75 0.4
76 0.32
77 0.26
78 0.26
79 0.23
80 0.2
81 0.18
82 0.12
83 0.12
84 0.13
85 0.12
86 0.1
87 0.12
88 0.13
89 0.13
90 0.19
91 0.23
92 0.23
93 0.24
94 0.23
95 0.23
96 0.24
97 0.26
98 0.21
99 0.17
100 0.16
101 0.18
102 0.21
103 0.2
104 0.22
105 0.24
106 0.24
107 0.24
108 0.24
109 0.25
110 0.24
111 0.23
112 0.23
113 0.19
114 0.17
115 0.16
116 0.15
117 0.11
118 0.1
119 0.11
120 0.08
121 0.08
122 0.08
123 0.1
124 0.14
125 0.15
126 0.16
127 0.16
128 0.19
129 0.2
130 0.23
131 0.24
132 0.23
133 0.22
134 0.22
135 0.23
136 0.26
137 0.32