Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6RKD2

Protein Details
Accession A0A2Z6RKD2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MSKLKVKKCDNCKKKRNVVNEIHRICHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito_nucl 12.166, cyto_nucl 9.833, mito 9.5
Family & Domain DBs
Gene Ontology GO:0016301  F:kinase activity  
GO:0016310  P:phosphorylation  
Amino Acid Sequences MSKLKVKKCDNCKKKRNVVNEIHRICHQCYKAKTVTLSGNKVIDDFIKSTLSNYDYNYRKANLEFVPYNRFKDIEFVAEGGFSKIYKATWIDGPLSNKWNEEKQEFAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.9
3 0.88
4 0.87
5 0.86
6 0.86
7 0.86
8 0.79
9 0.71
10 0.67
11 0.6
12 0.53
13 0.5
14 0.43
15 0.41
16 0.4
17 0.44
18 0.43
19 0.43
20 0.41
21 0.37
22 0.42
23 0.39
24 0.4
25 0.35
26 0.32
27 0.29
28 0.28
29 0.25
30 0.17
31 0.13
32 0.11
33 0.1
34 0.11
35 0.11
36 0.11
37 0.12
38 0.14
39 0.13
40 0.14
41 0.2
42 0.21
43 0.23
44 0.25
45 0.24
46 0.23
47 0.22
48 0.25
49 0.19
50 0.21
51 0.21
52 0.22
53 0.28
54 0.29
55 0.31
56 0.27
57 0.26
58 0.22
59 0.23
60 0.22
61 0.17
62 0.16
63 0.15
64 0.14
65 0.14
66 0.14
67 0.11
68 0.1
69 0.07
70 0.07
71 0.07
72 0.07
73 0.1
74 0.11
75 0.13
76 0.16
77 0.19
78 0.21
79 0.25
80 0.3
81 0.31
82 0.34
83 0.33
84 0.32
85 0.33
86 0.37
87 0.38
88 0.37