Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6S0S6

Protein Details
Accession A0A2Z6S0S6    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
33-57LLLFLQKKIKKKKCAKTASVQRPTSHydrophilic
NLS Segment(s)
PositionSequence
42-44KKK
Subcellular Location(s) nucl 18, cyto_nucl 11.5, mito 6
Family & Domain DBs
Amino Acid Sequences MFKTAKLLKKTRTAQPYPSGRRLRGYHTTHLRLLLFLQKKIKKKKCAKTASVQRPTSDRTVPTISSGIRSYILT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.67
3 0.71
4 0.69
5 0.72
6 0.69
7 0.61
8 0.63
9 0.59
10 0.56
11 0.55
12 0.53
13 0.52
14 0.54
15 0.56
16 0.5
17 0.5
18 0.43
19 0.33
20 0.29
21 0.28
22 0.22
23 0.21
24 0.28
25 0.31
26 0.39
27 0.49
28 0.57
29 0.6
30 0.68
31 0.76
32 0.78
33 0.82
34 0.8
35 0.8
36 0.83
37 0.83
38 0.83
39 0.75
40 0.66
41 0.6
42 0.58
43 0.52
44 0.45
45 0.35
46 0.31
47 0.33
48 0.32
49 0.31
50 0.31
51 0.27
52 0.27
53 0.26
54 0.23