Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6QG41

Protein Details
Accession A0A2Z6QG41    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
19-44TLLFQSQKKSARKKLKKLQQQQQTPDHydrophilic
NLS Segment(s)
PositionSequence
27-34KSARKKLK
Subcellular Location(s) mito 10, nucl 8.5, cyto_nucl 7.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MGTVPSTPHYSNPITLPATLLFQSQKKSARKKLKKLQQQQQTPDDNPFIVSSGQSPEQIPPVQRWLVTFNNIPSLPVTSLKSSDNKKPLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.25
3 0.25
4 0.2
5 0.2
6 0.18
7 0.18
8 0.16
9 0.17
10 0.19
11 0.22
12 0.3
13 0.35
14 0.44
15 0.52
16 0.61
17 0.68
18 0.76
19 0.82
20 0.84
21 0.86
22 0.88
23 0.87
24 0.85
25 0.83
26 0.79
27 0.76
28 0.7
29 0.61
30 0.53
31 0.44
32 0.34
33 0.27
34 0.21
35 0.14
36 0.1
37 0.09
38 0.07
39 0.09
40 0.1
41 0.1
42 0.11
43 0.11
44 0.14
45 0.16
46 0.16
47 0.15
48 0.19
49 0.2
50 0.19
51 0.2
52 0.22
53 0.23
54 0.26
55 0.26
56 0.23
57 0.28
58 0.28
59 0.27
60 0.23
61 0.23
62 0.21
63 0.22
64 0.23
65 0.19
66 0.22
67 0.24
68 0.31
69 0.33
70 0.4