Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6QYJ6

Protein Details
Accession A0A2Z6QYJ6    Localization Confidence High Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
27-52TDVNSSTPKKKAKKPVRREDSPILKKHydrophilic
NLS Segment(s)
PositionSequence
34-45PKKKAKKPVRRE
Subcellular Location(s) nucl 24, cyto 2
Family & Domain DBs
Amino Acid Sequences MELEEEMDVDGEEEPDTSSKKRSNEDTDVNSSTPKKKAKKPVRREDSPILKKLIKELSALIPQQTSSGGTISLQTFSDMNIDSVNFCELNDRIIKAKDDNKRTTLKLIHSYYYFGKGYRLWFDHYKKTYSDDTSNSLVNDKIRKYFPD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.09
3 0.12
4 0.12
5 0.18
6 0.23
7 0.27
8 0.33
9 0.4
10 0.46
11 0.52
12 0.58
13 0.58
14 0.59
15 0.57
16 0.52
17 0.48
18 0.44
19 0.4
20 0.4
21 0.42
22 0.44
23 0.5
24 0.6
25 0.68
26 0.75
27 0.82
28 0.86
29 0.87
30 0.85
31 0.83
32 0.82
33 0.82
34 0.77
35 0.69
36 0.63
37 0.55
38 0.49
39 0.47
40 0.41
41 0.31
42 0.26
43 0.24
44 0.23
45 0.25
46 0.25
47 0.21
48 0.16
49 0.15
50 0.15
51 0.13
52 0.09
53 0.06
54 0.06
55 0.06
56 0.06
57 0.07
58 0.07
59 0.08
60 0.07
61 0.07
62 0.07
63 0.07
64 0.08
65 0.07
66 0.07
67 0.06
68 0.06
69 0.06
70 0.06
71 0.07
72 0.06
73 0.05
74 0.08
75 0.07
76 0.1
77 0.11
78 0.11
79 0.13
80 0.14
81 0.16
82 0.18
83 0.26
84 0.31
85 0.38
86 0.42
87 0.44
88 0.47
89 0.47
90 0.49
91 0.46
92 0.44
93 0.44
94 0.43
95 0.41
96 0.37
97 0.39
98 0.34
99 0.35
100 0.3
101 0.21
102 0.21
103 0.2
104 0.23
105 0.27
106 0.27
107 0.27
108 0.36
109 0.41
110 0.48
111 0.5
112 0.49
113 0.44
114 0.47
115 0.48
116 0.45
117 0.45
118 0.39
119 0.4
120 0.4
121 0.4
122 0.36
123 0.32
124 0.28
125 0.28
126 0.31
127 0.29
128 0.32