Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6RPL3

Protein Details
Accession A0A2Z6RPL3    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-33MVVIGNKRNKKARNCLPQKKRRQWNVREKLIIVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 10.5, mito 7, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018586  Brinker_DNA-bd  
IPR006600  HTH_CenpB_DNA-bd_dom  
IPR010921  Trp_repressor/repl_initiator  
Gene Ontology GO:0043565  F:sequence-specific DNA binding  
Pfam View protein in Pfam  
PF09607  BrkDBD  
PROSITE View protein in PROSITE  
PS51253  HTH_CENPB  
Amino Acid Sequences MVVIGNKRNKKARNCLPQKKRRQWNVREKLIIVHYFENNNRNVCGTAKKFNIQSKQLRDWSNKKGTLLTTASHVAKLHSGKPAKYPKLEDDLFAWISEKRANGNAITQKIITNKAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.87
3 0.89
4 0.91
5 0.93
6 0.93
7 0.93
8 0.93
9 0.92
10 0.92
11 0.92
12 0.92
13 0.89
14 0.82
15 0.72
16 0.65
17 0.6
18 0.51
19 0.42
20 0.35
21 0.28
22 0.28
23 0.3
24 0.3
25 0.27
26 0.26
27 0.24
28 0.22
29 0.21
30 0.19
31 0.23
32 0.22
33 0.26
34 0.27
35 0.3
36 0.34
37 0.38
38 0.43
39 0.43
40 0.46
41 0.47
42 0.5
43 0.53
44 0.52
45 0.52
46 0.52
47 0.53
48 0.54
49 0.49
50 0.43
51 0.4
52 0.36
53 0.35
54 0.31
55 0.23
56 0.18
57 0.2
58 0.2
59 0.19
60 0.18
61 0.14
62 0.16
63 0.18
64 0.18
65 0.22
66 0.24
67 0.24
68 0.33
69 0.42
70 0.43
71 0.46
72 0.47
73 0.44
74 0.5
75 0.49
76 0.41
77 0.34
78 0.34
79 0.3
80 0.26
81 0.23
82 0.15
83 0.17
84 0.18
85 0.16
86 0.14
87 0.17
88 0.19
89 0.19
90 0.27
91 0.32
92 0.32
93 0.34
94 0.32
95 0.32
96 0.33