Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6RVS3

Protein Details
Accession A0A2Z6RVS3    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
69-89EAIKERKKKVQLYHRRNKGEHBasic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 13, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR006594  LisH  
PROSITE View protein in PROSITE  
PS50896  LISH  
Amino Acid Sequences MAQPINSEEFRKRAKRLLEAFVYDYLRKSGCTDTARTYFEEAGLDNWPPEWLITLITKNEITTKNQENEAIKERKKKVQLYHRRNKGEHVNDEDEHKEEGNEERIEELASLKIVKSNKRILNAGKAQKENNEEIREDTNFKNVKEDDTKTSDARNNYRYSNKVMGTTSTDATNLPCFNKSSPGYSAQRTFPNNELPSIPLPLDVPDGFLNEWWLTFWDLFSSLYEQEHNSGIPYHNSFE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.6
3 0.63
4 0.64
5 0.61
6 0.58
7 0.56
8 0.53
9 0.5
10 0.41
11 0.36
12 0.3
13 0.25
14 0.22
15 0.22
16 0.2
17 0.24
18 0.27
19 0.29
20 0.34
21 0.39
22 0.4
23 0.39
24 0.39
25 0.32
26 0.29
27 0.26
28 0.19
29 0.16
30 0.16
31 0.14
32 0.11
33 0.11
34 0.1
35 0.09
36 0.09
37 0.08
38 0.07
39 0.09
40 0.11
41 0.13
42 0.14
43 0.16
44 0.16
45 0.15
46 0.2
47 0.2
48 0.22
49 0.26
50 0.32
51 0.33
52 0.34
53 0.38
54 0.35
55 0.37
56 0.42
57 0.43
58 0.41
59 0.48
60 0.51
61 0.54
62 0.59
63 0.61
64 0.62
65 0.65
66 0.72
67 0.73
68 0.79
69 0.82
70 0.81
71 0.75
72 0.71
73 0.7
74 0.66
75 0.6
76 0.57
77 0.52
78 0.45
79 0.47
80 0.43
81 0.34
82 0.27
83 0.22
84 0.15
85 0.11
86 0.13
87 0.15
88 0.14
89 0.12
90 0.12
91 0.12
92 0.12
93 0.11
94 0.1
95 0.05
96 0.06
97 0.06
98 0.05
99 0.08
100 0.11
101 0.14
102 0.18
103 0.26
104 0.29
105 0.31
106 0.34
107 0.32
108 0.38
109 0.42
110 0.44
111 0.41
112 0.4
113 0.38
114 0.39
115 0.41
116 0.36
117 0.34
118 0.3
119 0.25
120 0.26
121 0.27
122 0.25
123 0.24
124 0.21
125 0.24
126 0.24
127 0.23
128 0.26
129 0.24
130 0.28
131 0.29
132 0.32
133 0.29
134 0.32
135 0.34
136 0.3
137 0.34
138 0.34
139 0.34
140 0.37
141 0.37
142 0.34
143 0.36
144 0.4
145 0.39
146 0.4
147 0.41
148 0.37
149 0.35
150 0.33
151 0.3
152 0.3
153 0.3
154 0.25
155 0.19
156 0.18
157 0.16
158 0.17
159 0.18
160 0.15
161 0.14
162 0.15
163 0.16
164 0.17
165 0.24
166 0.24
167 0.25
168 0.26
169 0.32
170 0.34
171 0.37
172 0.4
173 0.36
174 0.42
175 0.4
176 0.41
177 0.37
178 0.43
179 0.39
180 0.37
181 0.34
182 0.31
183 0.3
184 0.28
185 0.25
186 0.16
187 0.16
188 0.15
189 0.18
190 0.14
191 0.15
192 0.14
193 0.16
194 0.15
195 0.15
196 0.17
197 0.13
198 0.13
199 0.11
200 0.12
201 0.13
202 0.13
203 0.13
204 0.11
205 0.12
206 0.13
207 0.14
208 0.15
209 0.14
210 0.15
211 0.17
212 0.17
213 0.18
214 0.18
215 0.17
216 0.15
217 0.17
218 0.18
219 0.22