Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6QTG2

Protein Details
Accession A0A2Z6QTG2    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
46-72VTSLTKSQKRNAKKKAQRSPCDYKLLLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 13.833, cyto 5, cyto_pero 3.499
Family & Domain DBs
Amino Acid Sequences MENLENPMHQSDMLINVDMIDGDLKGLLDDESLSATFPRNNTPLPVTSLTKSQKRNAKKKAQRSPCDYKLLLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.12
3 0.12
4 0.12
5 0.11
6 0.1
7 0.06
8 0.04
9 0.04
10 0.04
11 0.04
12 0.04
13 0.04
14 0.04
15 0.04
16 0.04
17 0.04
18 0.05
19 0.05
20 0.05
21 0.05
22 0.06
23 0.07
24 0.08
25 0.1
26 0.12
27 0.12
28 0.14
29 0.16
30 0.16
31 0.2
32 0.22
33 0.22
34 0.21
35 0.28
36 0.32
37 0.36
38 0.39
39 0.42
40 0.48
41 0.56
42 0.65
43 0.68
44 0.74
45 0.77
46 0.84
47 0.88
48 0.9
49 0.89
50 0.88
51 0.88
52 0.83
53 0.81