Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6QPC8

Protein Details
Accession A0A2Z6QPC8    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
78-99ISVIVKKQKKYKTVRCKLNIMHHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 9, cyto_nucl 7, nucl 6.5, cyto 6.5, pero 4
Family & Domain DBs
Amino Acid Sequences MSVLSSSSTLKPDAKSFVPKIKKVKTTVSDPNATHIITGYHSNPSLGQYVCDILIYDIPAKWDNVKLLEYLKVWGNIISVIVKKQKKYKTVRCKLNIMHAFSIWKKDRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.36
3 0.39
4 0.46
5 0.5
6 0.54
7 0.6
8 0.64
9 0.67
10 0.63
11 0.67
12 0.62
13 0.62
14 0.65
15 0.61
16 0.59
17 0.53
18 0.52
19 0.45
20 0.39
21 0.32
22 0.22
23 0.17
24 0.12
25 0.14
26 0.11
27 0.12
28 0.12
29 0.12
30 0.12
31 0.13
32 0.14
33 0.12
34 0.11
35 0.1
36 0.1
37 0.1
38 0.1
39 0.08
40 0.05
41 0.06
42 0.06
43 0.06
44 0.05
45 0.07
46 0.08
47 0.08
48 0.09
49 0.1
50 0.11
51 0.12
52 0.12
53 0.11
54 0.12
55 0.14
56 0.14
57 0.14
58 0.15
59 0.14
60 0.13
61 0.13
62 0.12
63 0.1
64 0.1
65 0.1
66 0.09
67 0.12
68 0.2
69 0.23
70 0.27
71 0.36
72 0.42
73 0.5
74 0.59
75 0.67
76 0.71
77 0.77
78 0.84
79 0.82
80 0.83
81 0.78
82 0.78
83 0.74
84 0.68
85 0.6
86 0.51
87 0.51
88 0.44
89 0.5