Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6S3C9

Protein Details
Accession A0A2Z6S3C9    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
23-51DDKIKGNKISRCNKCKKIKPKQENIVTVPHydrophilic
65-85NKKWILRKISIKKQRRYKSVKHydrophilic
NLS Segment(s)
PositionSequence
71-80RKISIKKQRR
Subcellular Location(s) nucl 21, mito_nucl 13.833, cyto_nucl 11.333, mito 5.5
Family & Domain DBs
Amino Acid Sequences MRSLLNTEKFKIKNSTENDKINDDKIKGNKISRCNKCKKIKPKQENIVTVPVDQAPSIENSKYNNKKWILRKISIKKQRRYKSVKISVNWIRSKERSSDEKCLRIDLSYKEEIIVTRWFQGSWKAREIRDYLKNKLFTPILVDVTTENRPRYYDQLFRIYKIIITLYALNQLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.59
3 0.58
4 0.63
5 0.61
6 0.59
7 0.57
8 0.53
9 0.51
10 0.43
11 0.43
12 0.41
13 0.46
14 0.45
15 0.5
16 0.52
17 0.56
18 0.64
19 0.67
20 0.72
21 0.75
22 0.79
23 0.83
24 0.86
25 0.88
26 0.89
27 0.9
28 0.9
29 0.91
30 0.91
31 0.89
32 0.86
33 0.78
34 0.74
35 0.64
36 0.53
37 0.44
38 0.34
39 0.26
40 0.19
41 0.15
42 0.08
43 0.1
44 0.11
45 0.11
46 0.11
47 0.14
48 0.25
49 0.31
50 0.33
51 0.39
52 0.4
53 0.48
54 0.54
55 0.61
56 0.58
57 0.57
58 0.65
59 0.66
60 0.73
61 0.76
62 0.77
63 0.75
64 0.79
65 0.81
66 0.8
67 0.79
68 0.78
69 0.78
70 0.79
71 0.76
72 0.67
73 0.67
74 0.64
75 0.63
76 0.57
77 0.49
78 0.43
79 0.38
80 0.39
81 0.35
82 0.33
83 0.34
84 0.36
85 0.44
86 0.44
87 0.48
88 0.46
89 0.45
90 0.4
91 0.33
92 0.32
93 0.25
94 0.26
95 0.21
96 0.21
97 0.19
98 0.19
99 0.19
100 0.18
101 0.18
102 0.13
103 0.14
104 0.14
105 0.14
106 0.14
107 0.23
108 0.28
109 0.29
110 0.35
111 0.37
112 0.38
113 0.42
114 0.46
115 0.44
116 0.46
117 0.48
118 0.47
119 0.5
120 0.52
121 0.48
122 0.5
123 0.43
124 0.34
125 0.34
126 0.3
127 0.26
128 0.23
129 0.23
130 0.19
131 0.22
132 0.27
133 0.25
134 0.24
135 0.22
136 0.24
137 0.27
138 0.32
139 0.35
140 0.37
141 0.38
142 0.47
143 0.48
144 0.48
145 0.47
146 0.41
147 0.36
148 0.3
149 0.26
150 0.16
151 0.17
152 0.18
153 0.16