Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6SII2

Protein Details
Accession A0A2Z6SII2    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-41MSELDSKKRTRNKTKNDDDSLDKPQPKKNRGKAIKKEEIKDHydrophilic
NLS Segment(s)
PositionSequence
23-36KPQPKKNRGKAIKK
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR001005  SANT/Myb  
Pfam View protein in Pfam  
PF00249  Myb_DNA-binding  
PROSITE View protein in PROSITE  
PS50090  MYB_LIKE  
CDD cd00167  SANT  
Amino Acid Sequences MSELDSKKRTRNKTKNDDDSLDKPQPKKNRGKAIKKEEIKDVAPLESNVSSSLENENEVDDSSQAQSSKKWSPEQRLQLIEAVLKHVKVPWDEVCNEVDGGKNGKMCYDQWRRKIVPGLKTFIKSEHEH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.9
3 0.88
4 0.82
5 0.77
6 0.72
7 0.69
8 0.66
9 0.6
10 0.54
11 0.54
12 0.59
13 0.62
14 0.67
15 0.68
16 0.72
17 0.77
18 0.84
19 0.87
20 0.88
21 0.89
22 0.84
23 0.78
24 0.72
25 0.66
26 0.56
27 0.49
28 0.4
29 0.31
30 0.26
31 0.23
32 0.19
33 0.15
34 0.14
35 0.11
36 0.11
37 0.1
38 0.1
39 0.11
40 0.09
41 0.09
42 0.09
43 0.09
44 0.08
45 0.08
46 0.07
47 0.06
48 0.06
49 0.06
50 0.07
51 0.07
52 0.07
53 0.08
54 0.12
55 0.17
56 0.19
57 0.26
58 0.29
59 0.37
60 0.45
61 0.51
62 0.52
63 0.49
64 0.47
65 0.42
66 0.38
67 0.32
68 0.23
69 0.2
70 0.15
71 0.13
72 0.13
73 0.13
74 0.15
75 0.14
76 0.18
77 0.18
78 0.21
79 0.22
80 0.23
81 0.23
82 0.21
83 0.21
84 0.17
85 0.15
86 0.12
87 0.15
88 0.15
89 0.17
90 0.16
91 0.17
92 0.18
93 0.19
94 0.27
95 0.35
96 0.42
97 0.47
98 0.56
99 0.57
100 0.61
101 0.69
102 0.65
103 0.64
104 0.62
105 0.61
106 0.58
107 0.59
108 0.54
109 0.49