Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6RPV1

Protein Details
Accession A0A2Z6RPV1    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
101-128FKHFQEKQYKSKPKSKANKFKSNKAVTEHydrophilic
NLS Segment(s)
PositionSequence
112-118KPKSKAN
Subcellular Location(s) cyto_nucl 9, nucl 8.5, cyto 8.5, mito 7
Family & Domain DBs
Amino Acid Sequences MDTKYKPVHHLNGAGQQLISVPCYGFYDIPIPPAKFYEFKNYRKVNGFMLFRTLIQKSFSQGVGYSSHKSSKIWAAADEDFKEIFVKIANDINKMEKEIEFKHFQEKQYKSKPKSKANKFKSNKAVTEPVKQEATIGDIFQDDVNCFSFTSFQNP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.38
3 0.31
4 0.27
5 0.22
6 0.18
7 0.11
8 0.09
9 0.09
10 0.12
11 0.13
12 0.11
13 0.12
14 0.15
15 0.14
16 0.18
17 0.23
18 0.22
19 0.21
20 0.23
21 0.24
22 0.23
23 0.25
24 0.32
25 0.35
26 0.39
27 0.48
28 0.49
29 0.51
30 0.54
31 0.53
32 0.48
33 0.47
34 0.44
35 0.35
36 0.36
37 0.32
38 0.27
39 0.28
40 0.23
41 0.18
42 0.18
43 0.18
44 0.16
45 0.17
46 0.17
47 0.14
48 0.14
49 0.14
50 0.15
51 0.17
52 0.17
53 0.16
54 0.18
55 0.18
56 0.18
57 0.18
58 0.2
59 0.2
60 0.19
61 0.18
62 0.2
63 0.21
64 0.22
65 0.21
66 0.17
67 0.14
68 0.13
69 0.13
70 0.09
71 0.08
72 0.07
73 0.07
74 0.07
75 0.11
76 0.12
77 0.13
78 0.14
79 0.17
80 0.17
81 0.17
82 0.17
83 0.14
84 0.17
85 0.18
86 0.22
87 0.23
88 0.24
89 0.31
90 0.34
91 0.37
92 0.42
93 0.45
94 0.5
95 0.57
96 0.66
97 0.64
98 0.68
99 0.74
100 0.75
101 0.81
102 0.83
103 0.83
104 0.82
105 0.87
106 0.84
107 0.85
108 0.85
109 0.81
110 0.73
111 0.68
112 0.68
113 0.61
114 0.64
115 0.57
116 0.51
117 0.45
118 0.42
119 0.36
120 0.27
121 0.27
122 0.19
123 0.16
124 0.12
125 0.11
126 0.12
127 0.13
128 0.13
129 0.1
130 0.11
131 0.13
132 0.13
133 0.13
134 0.12
135 0.15