Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6S5V5

Protein Details
Accession A0A2Z6S5V5    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-37MVRHRSKGAKVKKVLRRIERKKKRKEIQEKPNHTTRCBasic
NLS Segment(s)
PositionSequence
4-26HRSKGAKVKKVLRRIERKKKRKE
Subcellular Location(s) nucl 21.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences MVRHRSKGAKVKKVLRRIERKKKRKEIQEKPNHTTRCGKCNTCLEVKENYKRWIKEEITIFQIKECEML
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.82
3 0.83
4 0.84
5 0.87
6 0.88
7 0.9
8 0.91
9 0.93
10 0.91
11 0.91
12 0.91
13 0.9
14 0.9
15 0.91
16 0.88
17 0.82
18 0.81
19 0.71
20 0.62
21 0.61
22 0.53
23 0.5
24 0.47
25 0.43
26 0.4
27 0.45
28 0.47
29 0.42
30 0.41
31 0.36
32 0.4
33 0.45
34 0.49
35 0.48
36 0.5
37 0.53
38 0.52
39 0.52
40 0.53
41 0.48
42 0.46
43 0.47
44 0.44
45 0.43
46 0.45
47 0.42
48 0.35
49 0.34