Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6RHC2

Protein Details
Accession A0A2Z6RHC2    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
105-130PNSDIICRKKLKRKSIKEIIKRNLEFHydrophilic
NLS Segment(s)
PositionSequence
112-122RKKLKRKSIKE
Subcellular Location(s) nucl 20, cyto_nucl 12, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004088  KH_dom_type_1  
IPR036612  KH_dom_type_1_sf  
Gene Ontology GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF00013  KH_1  
Amino Acid Sequences MEKQTQNLFIPIPHRTEIDKLIGREGCNLKPITERTGTYTYIDKETNSSQIKYLYDEENENVEVPQTTLTTTTTTTNTVNEDLPEKFSKTIFKEKRNKDVSKKLPNSDIICRKKLKRKSIKEIIKRNLEFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.26
3 0.28
4 0.29
5 0.32
6 0.34
7 0.31
8 0.35
9 0.36
10 0.34
11 0.38
12 0.39
13 0.32
14 0.33
15 0.32
16 0.27
17 0.3
18 0.32
19 0.29
20 0.29
21 0.28
22 0.29
23 0.31
24 0.31
25 0.27
26 0.29
27 0.26
28 0.25
29 0.25
30 0.19
31 0.19
32 0.2
33 0.26
34 0.24
35 0.23
36 0.21
37 0.23
38 0.23
39 0.23
40 0.24
41 0.18
42 0.17
43 0.17
44 0.17
45 0.16
46 0.16
47 0.13
48 0.11
49 0.09
50 0.08
51 0.07
52 0.06
53 0.05
54 0.05
55 0.05
56 0.06
57 0.07
58 0.08
59 0.09
60 0.1
61 0.11
62 0.12
63 0.12
64 0.13
65 0.13
66 0.13
67 0.12
68 0.13
69 0.12
70 0.16
71 0.16
72 0.16
73 0.16
74 0.16
75 0.21
76 0.24
77 0.34
78 0.38
79 0.47
80 0.56
81 0.61
82 0.71
83 0.74
84 0.77
85 0.75
86 0.78
87 0.78
88 0.79
89 0.79
90 0.73
91 0.7
92 0.69
93 0.64
94 0.63
95 0.63
96 0.59
97 0.59
98 0.62
99 0.65
100 0.68
101 0.74
102 0.75
103 0.76
104 0.8
105 0.84
106 0.88
107 0.9
108 0.91
109 0.92
110 0.9
111 0.89