Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6RX77

Protein Details
Accession A0A2Z6RX77    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MYKKTYKSNIEKPKKDSRTFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, mito 8
Family & Domain DBs
Amino Acid Sequences MYKKTYKSNIEKPKKDSRTFYHEAEKNEKPVLLLEAQKIANQAYKDGIKEIYKLTVDTLKKNDSYEMDKYMTSLSHISNIVTTVAKHQQPQQPPPSPPPQMSHSIYQFNMKLKFINYLITY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.79
3 0.77
4 0.73
5 0.71
6 0.68
7 0.65
8 0.64
9 0.6
10 0.59
11 0.58
12 0.54
13 0.48
14 0.45
15 0.4
16 0.3
17 0.27
18 0.24
19 0.2
20 0.19
21 0.17
22 0.19
23 0.19
24 0.2
25 0.19
26 0.17
27 0.17
28 0.15
29 0.15
30 0.14
31 0.15
32 0.14
33 0.15
34 0.17
35 0.14
36 0.15
37 0.15
38 0.15
39 0.14
40 0.13
41 0.13
42 0.17
43 0.18
44 0.2
45 0.22
46 0.21
47 0.22
48 0.22
49 0.22
50 0.18
51 0.22
52 0.21
53 0.21
54 0.2
55 0.19
56 0.19
57 0.18
58 0.16
59 0.13
60 0.12
61 0.09
62 0.11
63 0.11
64 0.11
65 0.1
66 0.11
67 0.11
68 0.1
69 0.1
70 0.11
71 0.17
72 0.18
73 0.2
74 0.27
75 0.33
76 0.39
77 0.47
78 0.52
79 0.53
80 0.55
81 0.6
82 0.61
83 0.59
84 0.55
85 0.51
86 0.46
87 0.46
88 0.46
89 0.46
90 0.42
91 0.42
92 0.4
93 0.42
94 0.41
95 0.4
96 0.4
97 0.34
98 0.33
99 0.29
100 0.34
101 0.29