Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6QZE1

Protein Details
Accession A0A2Z6QZE1    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
54-78VTPLTKSQKQNAKKKARKERKKLQLHydrophilic
NLS Segment(s)
PositionSequence
63-76QNAKKKARKERKKL
Subcellular Location(s) nucl 20, cyto_nucl 14.5, cyto 7
Family & Domain DBs
Amino Acid Sequences METDKTQISQYEKSRDPIHQSDILFNYNVDDDLQGLLNNSPGATPSRNITLISVTPLTKSQKQNAKKKARKERKKLQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.47
3 0.5
4 0.46
5 0.45
6 0.42
7 0.39
8 0.4
9 0.38
10 0.36
11 0.28
12 0.24
13 0.19
14 0.15
15 0.14
16 0.1
17 0.07
18 0.06
19 0.06
20 0.07
21 0.06
22 0.06
23 0.06
24 0.06
25 0.06
26 0.05
27 0.04
28 0.05
29 0.07
30 0.08
31 0.08
32 0.09
33 0.12
34 0.13
35 0.14
36 0.13
37 0.13
38 0.13
39 0.15
40 0.15
41 0.13
42 0.13
43 0.17
44 0.22
45 0.27
46 0.31
47 0.37
48 0.45
49 0.54
50 0.64
51 0.7
52 0.77
53 0.77
54 0.83
55 0.87
56 0.89
57 0.9
58 0.91