Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6RSJ0

Protein Details
Accession A0A2Z6RSJ0    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
309-332NKESHAEKKIPPRRKLNENEAKDIHydrophilic
NLS Segment(s)
PositionSequence
316-322KKIPPRR
Subcellular Location(s) nucl 14.5, cyto_nucl 11.5, cyto 7.5, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR043502  DNA/RNA_pol_sf  
Amino Acid Sequences MAFWLFEKLSVGIPTNEPLDTLETQWISKAMMGGIIWAQNNWKEYGRRYDETSLYPSIQQLALNFSIGKGKFQILKDFTNHRGYSHNGAPNALIYEKETRIQGKVIFGEYVDFLFKIKNQGGIVSQVAKRILNTLWGALCQRKKTYKTLTTSSNPFKGEYPRIALFLLAHGRKITSETVQPYIDKVRRIHTDGFILEEDVNNSPLYTYSKDAFKTLKALKFEREGECSNKKMKHDLFPFTNKYPSFIKHETYLAEIIEALKNVILADLRDGYDKESYLIKNHVNYIKKIESANNPEGYIHYTAKKLLPNKESHAEKKIPPRRKLNENEAKDILAELLSNKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.21
3 0.2
4 0.17
5 0.17
6 0.19
7 0.18
8 0.18
9 0.21
10 0.2
11 0.2
12 0.21
13 0.2
14 0.16
15 0.16
16 0.15
17 0.1
18 0.11
19 0.1
20 0.11
21 0.12
22 0.14
23 0.13
24 0.12
25 0.15
26 0.17
27 0.19
28 0.2
29 0.23
30 0.25
31 0.29
32 0.39
33 0.44
34 0.44
35 0.47
36 0.51
37 0.5
38 0.49
39 0.49
40 0.42
41 0.35
42 0.33
43 0.28
44 0.24
45 0.22
46 0.19
47 0.15
48 0.17
49 0.16
50 0.16
51 0.15
52 0.13
53 0.19
54 0.18
55 0.19
56 0.16
57 0.19
58 0.23
59 0.25
60 0.34
61 0.31
62 0.35
63 0.38
64 0.42
65 0.44
66 0.47
67 0.45
68 0.38
69 0.38
70 0.37
71 0.39
72 0.4
73 0.4
74 0.32
75 0.32
76 0.31
77 0.28
78 0.26
79 0.2
80 0.13
81 0.11
82 0.15
83 0.16
84 0.17
85 0.18
86 0.18
87 0.19
88 0.21
89 0.21
90 0.19
91 0.2
92 0.19
93 0.17
94 0.16
95 0.15
96 0.13
97 0.12
98 0.09
99 0.08
100 0.07
101 0.07
102 0.08
103 0.12
104 0.13
105 0.15
106 0.15
107 0.16
108 0.17
109 0.19
110 0.19
111 0.18
112 0.18
113 0.17
114 0.18
115 0.17
116 0.16
117 0.16
118 0.15
119 0.14
120 0.14
121 0.13
122 0.12
123 0.13
124 0.14
125 0.17
126 0.21
127 0.2
128 0.24
129 0.29
130 0.32
131 0.39
132 0.46
133 0.49
134 0.5
135 0.52
136 0.54
137 0.51
138 0.55
139 0.52
140 0.47
141 0.4
142 0.36
143 0.34
144 0.32
145 0.31
146 0.26
147 0.26
148 0.23
149 0.23
150 0.22
151 0.2
152 0.15
153 0.14
154 0.17
155 0.13
156 0.13
157 0.12
158 0.12
159 0.12
160 0.14
161 0.13
162 0.09
163 0.12
164 0.14
165 0.17
166 0.18
167 0.18
168 0.17
169 0.22
170 0.23
171 0.24
172 0.23
173 0.26
174 0.29
175 0.33
176 0.34
177 0.29
178 0.3
179 0.26
180 0.26
181 0.21
182 0.19
183 0.15
184 0.12
185 0.12
186 0.1
187 0.1
188 0.08
189 0.08
190 0.07
191 0.08
192 0.1
193 0.1
194 0.12
195 0.13
196 0.16
197 0.17
198 0.19
199 0.2
200 0.18
201 0.24
202 0.28
203 0.3
204 0.31
205 0.33
206 0.34
207 0.37
208 0.41
209 0.36
210 0.35
211 0.34
212 0.36
213 0.39
214 0.39
215 0.41
216 0.4
217 0.39
218 0.43
219 0.44
220 0.47
221 0.48
222 0.51
223 0.51
224 0.55
225 0.59
226 0.52
227 0.55
228 0.45
229 0.43
230 0.39
231 0.36
232 0.36
233 0.34
234 0.34
235 0.3
236 0.32
237 0.29
238 0.29
239 0.27
240 0.19
241 0.16
242 0.14
243 0.13
244 0.12
245 0.11
246 0.08
247 0.07
248 0.07
249 0.07
250 0.08
251 0.06
252 0.06
253 0.08
254 0.09
255 0.1
256 0.12
257 0.12
258 0.14
259 0.15
260 0.15
261 0.14
262 0.17
263 0.18
264 0.2
265 0.25
266 0.26
267 0.26
268 0.33
269 0.38
270 0.38
271 0.39
272 0.43
273 0.41
274 0.41
275 0.4
276 0.4
277 0.42
278 0.46
279 0.5
280 0.45
281 0.42
282 0.4
283 0.39
284 0.36
285 0.31
286 0.26
287 0.22
288 0.22
289 0.24
290 0.28
291 0.33
292 0.36
293 0.41
294 0.45
295 0.48
296 0.54
297 0.6
298 0.63
299 0.63
300 0.64
301 0.61
302 0.61
303 0.66
304 0.69
305 0.71
306 0.72
307 0.77
308 0.77
309 0.81
310 0.84
311 0.84
312 0.85
313 0.81
314 0.79
315 0.7
316 0.63
317 0.53
318 0.44
319 0.33
320 0.22
321 0.17