Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6RAA1

Protein Details
Accession A0A2Z6RAA1    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
5-32YIQKINLNNNKRIRRKPPNPCPNCKETIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto_nucl 10, mito 9, cyto 5
Family & Domain DBs
Amino Acid Sequences MSYPYIQKINLNNNKRIRRKPPNPCPNCKETIDCVKLVSNEVDKIEEIINNFKNLQKKKSDKLSIFKANFTLNNIPYELEYDLSNFTLDNLHKLVTVTTQFYNTSKESSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.78
3 0.8
4 0.79
5 0.81
6 0.85
7 0.87
8 0.89
9 0.9
10 0.9
11 0.9
12 0.86
13 0.81
14 0.75
15 0.66
16 0.59
17 0.54
18 0.55
19 0.48
20 0.41
21 0.36
22 0.33
23 0.31
24 0.29
25 0.25
26 0.16
27 0.15
28 0.15
29 0.15
30 0.13
31 0.13
32 0.12
33 0.11
34 0.1
35 0.14
36 0.14
37 0.14
38 0.15
39 0.16
40 0.23
41 0.25
42 0.28
43 0.32
44 0.36
45 0.42
46 0.51
47 0.56
48 0.53
49 0.57
50 0.61
51 0.62
52 0.57
53 0.52
54 0.45
55 0.39
56 0.35
57 0.34
58 0.3
59 0.22
60 0.22
61 0.22
62 0.2
63 0.18
64 0.19
65 0.15
66 0.11
67 0.1
68 0.09
69 0.1
70 0.1
71 0.1
72 0.08
73 0.08
74 0.12
75 0.12
76 0.14
77 0.14
78 0.14
79 0.14
80 0.15
81 0.15
82 0.15
83 0.17
84 0.18
85 0.18
86 0.2
87 0.21
88 0.22
89 0.26
90 0.23