Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6QHG6

Protein Details
Accession A0A2Z6QHG6    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-42MNSFPKARLKRTKLENRQHYIPDFKKYYKILIKKKKNLEDLEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 11, mito 6
Family & Domain DBs
Gene Ontology GO:0016301  F:kinase activity  
GO:0016310  P:phosphorylation  
Amino Acid Sequences MNSFPKARLKRTKLENRQHYIPDFKKYYKILIKKKKNLEDLEKRKRVYVICGECNESGIGKEWYQLCNAKLTSGNKVIDEFIQPSQLNAAHNSNCLEWVPYENFKDFTYITNAFGKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.86
3 0.82
4 0.82
5 0.78
6 0.71
7 0.69
8 0.62
9 0.6
10 0.55
11 0.49
12 0.49
13 0.46
14 0.5
15 0.49
16 0.55
17 0.57
18 0.63
19 0.72
20 0.74
21 0.83
22 0.82
23 0.81
24 0.78
25 0.77
26 0.77
27 0.78
28 0.79
29 0.76
30 0.68
31 0.62
32 0.59
33 0.49
34 0.44
35 0.42
36 0.38
37 0.36
38 0.37
39 0.38
40 0.34
41 0.34
42 0.28
43 0.19
44 0.13
45 0.11
46 0.11
47 0.08
48 0.11
49 0.11
50 0.12
51 0.14
52 0.16
53 0.14
54 0.17
55 0.17
56 0.16
57 0.2
58 0.21
59 0.24
60 0.26
61 0.27
62 0.23
63 0.24
64 0.23
65 0.19
66 0.2
67 0.17
68 0.12
69 0.17
70 0.16
71 0.15
72 0.17
73 0.17
74 0.17
75 0.17
76 0.21
77 0.17
78 0.19
79 0.21
80 0.19
81 0.19
82 0.18
83 0.16
84 0.13
85 0.17
86 0.2
87 0.23
88 0.26
89 0.27
90 0.28
91 0.27
92 0.29
93 0.25
94 0.23
95 0.26
96 0.24
97 0.25