Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6SI05

Protein Details
Accession A0A2Z6SI05    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
67-90LQQIRTCKKLQERKEEKKRLVSIIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, cyto 3.5, cyto_nucl 3, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
CDD cd18809  SF1_C_RecD  
Amino Acid Sequences MVACSRLQIPLTLVWAITVHKSQGLTLPKAVIDLGNKEYAASLSFIAVSRISALKNILFKPFSFERLQQIRTCKKLQERKEEKKRLVSIIFYN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.13
4 0.13
5 0.13
6 0.1
7 0.12
8 0.12
9 0.12
10 0.18
11 0.22
12 0.22
13 0.22
14 0.22
15 0.2
16 0.2
17 0.2
18 0.15
19 0.11
20 0.12
21 0.13
22 0.13
23 0.13
24 0.12
25 0.12
26 0.11
27 0.1
28 0.08
29 0.06
30 0.05
31 0.06
32 0.06
33 0.06
34 0.06
35 0.05
36 0.06
37 0.06
38 0.06
39 0.07
40 0.08
41 0.09
42 0.13
43 0.14
44 0.17
45 0.17
46 0.17
47 0.23
48 0.23
49 0.25
50 0.24
51 0.25
52 0.31
53 0.36
54 0.39
55 0.37
56 0.44
57 0.48
58 0.5
59 0.52
60 0.5
61 0.54
62 0.61
63 0.66
64 0.68
65 0.72
66 0.78
67 0.86
68 0.89
69 0.85
70 0.86
71 0.82
72 0.77
73 0.7