Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6QWA9

Protein Details
Accession A0A2Z6QWA9    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
73-96PDTNKRWGRIKVRVRSKKLKLFVGHydrophilic
NLS Segment(s)
PositionSequence
80-90GRIKVRVRSKK
Subcellular Location(s) nucl 14, mito 8, cyto 3
Family & Domain DBs
Amino Acid Sequences MFIFFLFLGLEETDFSISKAQNSNLKQIEVFRKKLGVLLAPISKVHGWISRRNFEGLEPLLRQTSYLKAHSFPDTNKRWGRIKVRVRSKKLKLFVGIEPTGTMSKPLTIT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.12
4 0.13
5 0.16
6 0.19
7 0.22
8 0.28
9 0.3
10 0.38
11 0.36
12 0.36
13 0.34
14 0.36
15 0.44
16 0.43
17 0.43
18 0.36
19 0.35
20 0.34
21 0.36
22 0.31
23 0.22
24 0.18
25 0.18
26 0.19
27 0.18
28 0.17
29 0.17
30 0.15
31 0.14
32 0.13
33 0.14
34 0.15
35 0.22
36 0.28
37 0.3
38 0.31
39 0.31
40 0.3
41 0.25
42 0.27
43 0.21
44 0.19
45 0.15
46 0.15
47 0.14
48 0.14
49 0.14
50 0.11
51 0.15
52 0.16
53 0.18
54 0.18
55 0.19
56 0.22
57 0.25
58 0.26
59 0.24
60 0.3
61 0.32
62 0.39
63 0.41
64 0.43
65 0.45
66 0.51
67 0.56
68 0.57
69 0.62
70 0.64
71 0.72
72 0.78
73 0.81
74 0.84
75 0.85
76 0.84
77 0.8
78 0.76
79 0.71
80 0.65
81 0.61
82 0.58
83 0.5
84 0.41
85 0.35
86 0.31
87 0.27
88 0.23
89 0.2
90 0.12