Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6RDL4

Protein Details
Accession A0A2Z6RDL4    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
16-39ITASVQKKEITKRKKKHLILDNDDHydrophilic
NLS Segment(s)
PositionSequence
27-31KRKKK
Subcellular Location(s) nucl 12.5, mito 10.5, cyto_nucl 8.833, cyto_mito 7.833
Family & Domain DBs
Amino Acid Sequences MKEYYRLTSSNKVLLITASVQKKEITKRKKKHLILDNDDESISEENKIMLPSKQKKKTFVPKEVNLDEIDVKKGEIHKKLKEKHGCDIHKTGYCYIKDNRHLPSTTLHISMWTDEIIIIII
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.26
3 0.21
4 0.24
5 0.24
6 0.23
7 0.24
8 0.25
9 0.3
10 0.37
11 0.44
12 0.49
13 0.55
14 0.64
15 0.74
16 0.83
17 0.84
18 0.84
19 0.84
20 0.83
21 0.8
22 0.79
23 0.69
24 0.6
25 0.53
26 0.43
27 0.35
28 0.26
29 0.18
30 0.11
31 0.09
32 0.08
33 0.09
34 0.1
35 0.09
36 0.1
37 0.19
38 0.28
39 0.38
40 0.46
41 0.49
42 0.54
43 0.61
44 0.7
45 0.7
46 0.7
47 0.68
48 0.64
49 0.68
50 0.63
51 0.56
52 0.45
53 0.37
54 0.29
55 0.22
56 0.18
57 0.11
58 0.11
59 0.11
60 0.15
61 0.2
62 0.26
63 0.31
64 0.38
65 0.47
66 0.53
67 0.62
68 0.66
69 0.64
70 0.65
71 0.69
72 0.66
73 0.62
74 0.61
75 0.57
76 0.52
77 0.51
78 0.46
79 0.43
80 0.4
81 0.39
82 0.4
83 0.43
84 0.46
85 0.48
86 0.49
87 0.48
88 0.48
89 0.45
90 0.43
91 0.41
92 0.37
93 0.34
94 0.29
95 0.25
96 0.25
97 0.25
98 0.22
99 0.15
100 0.12
101 0.1