Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A1CQ06

Protein Details
Accession A1CQ06    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
29-50DESQPKKVRKTIRPTKLRETLQHydrophilic
NLS Segment(s)
PositionSequence
145-150KPEKKK
Subcellular Location(s) nucl 10.5, cyto_nucl 10.5, cyto 9.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000915  60S_ribosomal_L6E  
IPR041997  KOW_RPL6  
IPR014722  Rib_L2_dom2  
IPR008991  Translation_prot_SH3-like_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG act:ACLA_024420  -  
Pfam View protein in Pfam  
PF01159  Ribosomal_L6e  
CDD cd13156  KOW_RPL6  
Amino Acid Sequences MSDSQTKQFGKGQRTIPAQKAQKWYPVDDESQPKKVRKTIRPTKLRETLQPGTILILLAGRFRGKRVILLKHLDQGVLLVTGPFKINGVPLRRVNARYVIATSKRVDIGNVDQSVIEKVSAADYFTKEKKAEKKTEEAFFKQGEKPEKKKVASARASDQKAVDQSILASVKKEAFLGSYLASTFSLRNGDKPHEMKW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.61
3 0.6
4 0.63
5 0.63
6 0.63
7 0.66
8 0.61
9 0.61
10 0.58
11 0.54
12 0.51
13 0.48
14 0.45
15 0.43
16 0.49
17 0.46
18 0.52
19 0.55
20 0.53
21 0.54
22 0.57
23 0.61
24 0.6
25 0.66
26 0.68
27 0.73
28 0.78
29 0.81
30 0.83
31 0.82
32 0.76
33 0.71
34 0.69
35 0.62
36 0.55
37 0.49
38 0.39
39 0.31
40 0.28
41 0.21
42 0.13
43 0.1
44 0.08
45 0.07
46 0.08
47 0.09
48 0.09
49 0.1
50 0.14
51 0.13
52 0.19
53 0.24
54 0.3
55 0.33
56 0.38
57 0.38
58 0.38
59 0.38
60 0.32
61 0.26
62 0.2
63 0.15
64 0.1
65 0.09
66 0.04
67 0.04
68 0.05
69 0.05
70 0.05
71 0.05
72 0.05
73 0.07
74 0.12
75 0.16
76 0.2
77 0.21
78 0.24
79 0.27
80 0.28
81 0.27
82 0.27
83 0.24
84 0.2
85 0.2
86 0.21
87 0.2
88 0.21
89 0.21
90 0.18
91 0.18
92 0.18
93 0.16
94 0.14
95 0.16
96 0.19
97 0.18
98 0.17
99 0.15
100 0.16
101 0.16
102 0.14
103 0.1
104 0.05
105 0.05
106 0.06
107 0.06
108 0.07
109 0.08
110 0.09
111 0.14
112 0.15
113 0.18
114 0.18
115 0.24
116 0.32
117 0.39
118 0.46
119 0.46
120 0.53
121 0.56
122 0.62
123 0.62
124 0.57
125 0.52
126 0.45
127 0.45
128 0.4
129 0.4
130 0.42
131 0.44
132 0.47
133 0.53
134 0.59
135 0.57
136 0.6
137 0.62
138 0.63
139 0.62
140 0.61
141 0.6
142 0.61
143 0.62
144 0.58
145 0.51
146 0.44
147 0.39
148 0.35
149 0.26
150 0.18
151 0.15
152 0.19
153 0.2
154 0.17
155 0.16
156 0.16
157 0.17
158 0.18
159 0.18
160 0.13
161 0.12
162 0.13
163 0.13
164 0.12
165 0.12
166 0.11
167 0.12
168 0.13
169 0.13
170 0.12
171 0.12
172 0.18
173 0.18
174 0.23
175 0.27
176 0.32
177 0.4