Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6QA12

Protein Details
Accession A0A2Z6QA12    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
7-28VVDPWKKPSRHNKILTRDNMKIHydrophilic
66-86VYCGISRKKLHRAAYKQNELLHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 11, nucl 9, mito 3, pero 3
Family & Domain DBs
Amino Acid Sequences MDIIGAVVDPWKKPSRHNKILTRDNMKILQELVKDKIDWYLDELVGELEIRIGKLISIPTLWRSLVYCGISRKKLHRAAYKQNELL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.52
3 0.6
4 0.69
5 0.73
6 0.76
7 0.84
8 0.84
9 0.8
10 0.72
11 0.66
12 0.6
13 0.51
14 0.42
15 0.34
16 0.29
17 0.24
18 0.23
19 0.22
20 0.2
21 0.19
22 0.18
23 0.2
24 0.17
25 0.14
26 0.15
27 0.14
28 0.13
29 0.13
30 0.12
31 0.09
32 0.09
33 0.08
34 0.05
35 0.04
36 0.04
37 0.04
38 0.04
39 0.04
40 0.04
41 0.05
42 0.06
43 0.06
44 0.07
45 0.08
46 0.1
47 0.12
48 0.12
49 0.12
50 0.12
51 0.14
52 0.18
53 0.19
54 0.21
55 0.26
56 0.33
57 0.38
58 0.42
59 0.46
60 0.51
61 0.57
62 0.63
63 0.66
64 0.69
65 0.74
66 0.8