Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6S3V7

Protein Details
Accession A0A2Z6S3V7    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-34MARGNQREKAREKNLKKQPKQKKKDDGTTFKKRABasic
NLS Segment(s)
PositionSequence
7-25REKAREKNLKKQPKQKKKD
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007513  SERF-like_N  
IPR040211  SERF1/2  
Pfam View protein in Pfam  
PF04419  4F5  
Amino Acid Sequences MARGNQREKAREKNLKKQPKQKKKDDGTTFKKRAETDAEIMRQKQQKALEAKATENKSEDKSSDSTQNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.83
3 0.86
4 0.87
5 0.87
6 0.88
7 0.9
8 0.89
9 0.89
10 0.87
11 0.88
12 0.87
13 0.86
14 0.84
15 0.85
16 0.79
17 0.71
18 0.66
19 0.55
20 0.48
21 0.44
22 0.38
23 0.31
24 0.32
25 0.33
26 0.31
27 0.31
28 0.35
29 0.33
30 0.31
31 0.31
32 0.29
33 0.32
34 0.36
35 0.39
36 0.4
37 0.37
38 0.41
39 0.45
40 0.45
41 0.39
42 0.36
43 0.36
44 0.33
45 0.34
46 0.31
47 0.28
48 0.3
49 0.32