Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6SNT4

Protein Details
Accession A0A2Z6SNT4    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MSNKKQKKKANKNNNNNTSDTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 12.833, cyto 4, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR038922  HYPK_UBA  
IPR044034  NAC-like_UBA  
Pfam View protein in Pfam  
PF19026  HYPK_UBA  
CDD cd14361  UBA_HYPK  
Amino Acid Sequences MSNKKQKKKANKNNNNNTSDTTNNTSSSAAKTTETAQPAAPPTLSQTSKNDKAKVKEKEKEKEKEAPNVDDDQQAEESQQQGFKGQAGQAKKDMQAVEGYVAEGAEGEGIDESKLDKALNIVETVNEEQKRLNDQKLQKQKDAEKIKVSREDIEFIMKEMDVTKPEADKYLRENKGDLVEALRAMVNAC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.95
2 0.88
3 0.79
4 0.72
5 0.66
6 0.57
7 0.51
8 0.46
9 0.38
10 0.34
11 0.32
12 0.29
13 0.26
14 0.26
15 0.23
16 0.19
17 0.17
18 0.17
19 0.19
20 0.23
21 0.24
22 0.22
23 0.2
24 0.22
25 0.23
26 0.23
27 0.2
28 0.15
29 0.17
30 0.23
31 0.24
32 0.24
33 0.28
34 0.35
35 0.44
36 0.49
37 0.52
38 0.51
39 0.56
40 0.63
41 0.67
42 0.68
43 0.66
44 0.69
45 0.73
46 0.76
47 0.76
48 0.71
49 0.7
50 0.65
51 0.67
52 0.62
53 0.54
54 0.48
55 0.44
56 0.4
57 0.33
58 0.29
59 0.22
60 0.19
61 0.16
62 0.14
63 0.12
64 0.11
65 0.1
66 0.1
67 0.08
68 0.08
69 0.08
70 0.08
71 0.09
72 0.1
73 0.13
74 0.14
75 0.16
76 0.18
77 0.19
78 0.19
79 0.21
80 0.19
81 0.16
82 0.15
83 0.13
84 0.11
85 0.1
86 0.09
87 0.06
88 0.06
89 0.05
90 0.04
91 0.04
92 0.02
93 0.02
94 0.02
95 0.02
96 0.03
97 0.03
98 0.03
99 0.04
100 0.04
101 0.05
102 0.05
103 0.05
104 0.06
105 0.07
106 0.08
107 0.09
108 0.08
109 0.08
110 0.11
111 0.12
112 0.17
113 0.16
114 0.15
115 0.16
116 0.17
117 0.25
118 0.26
119 0.29
120 0.31
121 0.38
122 0.48
123 0.58
124 0.62
125 0.59
126 0.62
127 0.64
128 0.66
129 0.67
130 0.62
131 0.6
132 0.59
133 0.61
134 0.61
135 0.57
136 0.52
137 0.46
138 0.44
139 0.36
140 0.37
141 0.31
142 0.24
143 0.23
144 0.18
145 0.16
146 0.15
147 0.16
148 0.12
149 0.14
150 0.15
151 0.16
152 0.17
153 0.22
154 0.23
155 0.24
156 0.3
157 0.37
158 0.4
159 0.4
160 0.41
161 0.39
162 0.42
163 0.41
164 0.34
165 0.27
166 0.24
167 0.22
168 0.21
169 0.18