Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6QYH9

Protein Details
Accession A0A2Z6QYH9    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
14-40YSHSFRIFLRLKKRIKKNKKEEEIVVDHydrophilic
NLS Segment(s)
PositionSequence
24-33LKKRIKKNKK
Subcellular Location(s) mito 14, nucl 8.5, cyto_nucl 6.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MYLQHLYSVRNLLYSHSFRIFLRLKKRIKKNKKEEEIVVDEFKSNEKGSDNNSICSFVSKKEEIKEDVKEESIEESGNNNVQVVEEENKEVKEKVEISHNLTIHNYNTINNIIQTQQPEQPERPESESPFYYRVIKKIVKEVGNIVDKVAQVHKEAILKSNANKIQESTEVVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.31
3 0.29
4 0.31
5 0.28
6 0.37
7 0.4
8 0.39
9 0.47
10 0.51
11 0.59
12 0.67
13 0.78
14 0.81
15 0.86
16 0.89
17 0.9
18 0.92
19 0.92
20 0.88
21 0.82
22 0.79
23 0.74
24 0.66
25 0.57
26 0.46
27 0.37
28 0.31
29 0.27
30 0.22
31 0.15
32 0.13
33 0.13
34 0.14
35 0.17
36 0.27
37 0.27
38 0.27
39 0.27
40 0.28
41 0.26
42 0.28
43 0.25
44 0.17
45 0.21
46 0.21
47 0.23
48 0.25
49 0.28
50 0.29
51 0.32
52 0.33
53 0.3
54 0.29
55 0.27
56 0.23
57 0.2
58 0.17
59 0.14
60 0.11
61 0.09
62 0.08
63 0.08
64 0.09
65 0.08
66 0.07
67 0.06
68 0.06
69 0.06
70 0.07
71 0.08
72 0.08
73 0.09
74 0.1
75 0.1
76 0.11
77 0.11
78 0.09
79 0.1
80 0.11
81 0.11
82 0.18
83 0.19
84 0.23
85 0.28
86 0.28
87 0.26
88 0.26
89 0.26
90 0.19
91 0.21
92 0.16
93 0.12
94 0.14
95 0.14
96 0.14
97 0.12
98 0.13
99 0.11
100 0.12
101 0.14
102 0.15
103 0.18
104 0.2
105 0.24
106 0.24
107 0.28
108 0.29
109 0.3
110 0.33
111 0.33
112 0.33
113 0.34
114 0.35
115 0.33
116 0.32
117 0.3
118 0.32
119 0.31
120 0.31
121 0.33
122 0.36
123 0.35
124 0.42
125 0.47
126 0.42
127 0.42
128 0.42
129 0.43
130 0.43
131 0.4
132 0.33
133 0.28
134 0.26
135 0.26
136 0.26
137 0.2
138 0.17
139 0.19
140 0.21
141 0.23
142 0.24
143 0.26
144 0.29
145 0.31
146 0.32
147 0.4
148 0.4
149 0.39
150 0.39
151 0.36
152 0.35
153 0.34