Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6QHK8

Protein Details
Accession A0A2Z6QHK8    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
13-38QKINLDNNKRIRKKPSKPCSNCKETIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 11, mito 6, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MSYKQSRAQPYIQKINLDNNKRIRKKPSKPCSNCKETIDCVKLISNKVDKIEEIINNFKNLQKEKSDKFSIFKANFTLNNVTCGLEYDLSNFNLDYLHKLVAVTTQSYNTSKESSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.62
3 0.62
4 0.59
5 0.58
6 0.58
7 0.65
8 0.68
9 0.72
10 0.72
11 0.74
12 0.79
13 0.82
14 0.83
15 0.84
16 0.86
17 0.9
18 0.88
19 0.85
20 0.8
21 0.73
22 0.67
23 0.59
24 0.59
25 0.52
26 0.42
27 0.35
28 0.34
29 0.32
30 0.28
31 0.29
32 0.24
33 0.23
34 0.25
35 0.24
36 0.21
37 0.2
38 0.22
39 0.19
40 0.18
41 0.22
42 0.21
43 0.21
44 0.22
45 0.21
46 0.22
47 0.22
48 0.22
49 0.23
50 0.28
51 0.3
52 0.36
53 0.38
54 0.36
55 0.36
56 0.37
57 0.41
58 0.36
59 0.34
60 0.3
61 0.29
62 0.28
63 0.3
64 0.31
65 0.23
66 0.24
67 0.24
68 0.22
69 0.19
70 0.2
71 0.18
72 0.13
73 0.13
74 0.13
75 0.15
76 0.16
77 0.16
78 0.14
79 0.12
80 0.12
81 0.13
82 0.14
83 0.13
84 0.13
85 0.12
86 0.13
87 0.13
88 0.16
89 0.17
90 0.16
91 0.16
92 0.17
93 0.2
94 0.22
95 0.24
96 0.23