Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6QZK2

Protein Details
Accession A0A2Z6QZK2    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
234-258IVVTPKSEVKKKRKNIGKKIVSGKQHydrophilic
NLS Segment(s)
PositionSequence
242-253VKKKRKNIGKKI
Subcellular Location(s) nucl 15.5, cyto_nucl 12.833, mito_nucl 10.832, cyto 6, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR014752  Arrestin-like_C  
IPR014756  Ig_E-set  
Amino Acid Sequences MYSNLPKGPPRSSYKEFTPSIYFSYQQGLKSFQQGYLGITSNTSIVGFLHLNFPSNDPLYIKHIKLSFSGAEYIRLHDTGPQFLNYGTNSICNVSVDLWKSDNNDYQKISNLVLPFEVPLPNDIPSSLSLYKDRGRIEYNLRAIISRKPNLRNFQGSTKIIQCAYTVDRYSLPPSIPDPIKWENDKLRKGVGHEITLNNKVFGPRYPIVVRVKLTFYDARVSLEDIVISLKEYIVVTPKSEVKKKRKNIGKKIVSGKQIPISKETRYNECVTDIKFTIPDDCLCTFNWSEESFHIGITHKVKIKVNFGLFSKHNIKLEIPIKLTNMLTEEEESCLVAELVHQQEISRYLESETLRPRYDSPPPSYEPNLFTNQSSLPSYSPNNNVDSRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.64
3 0.6
4 0.57
5 0.55
6 0.48
7 0.46
8 0.43
9 0.37
10 0.3
11 0.35
12 0.34
13 0.31
14 0.31
15 0.32
16 0.31
17 0.37
18 0.37
19 0.31
20 0.31
21 0.29
22 0.29
23 0.28
24 0.27
25 0.2
26 0.19
27 0.18
28 0.15
29 0.14
30 0.12
31 0.08
32 0.06
33 0.09
34 0.1
35 0.1
36 0.15
37 0.15
38 0.17
39 0.18
40 0.19
41 0.21
42 0.21
43 0.22
44 0.18
45 0.2
46 0.25
47 0.3
48 0.29
49 0.29
50 0.3
51 0.3
52 0.31
53 0.33
54 0.27
55 0.23
56 0.28
57 0.23
58 0.26
59 0.25
60 0.27
61 0.24
62 0.23
63 0.21
64 0.21
65 0.23
66 0.22
67 0.23
68 0.21
69 0.2
70 0.2
71 0.22
72 0.18
73 0.18
74 0.13
75 0.13
76 0.13
77 0.13
78 0.14
79 0.11
80 0.12
81 0.11
82 0.15
83 0.15
84 0.16
85 0.16
86 0.18
87 0.2
88 0.23
89 0.28
90 0.28
91 0.3
92 0.3
93 0.3
94 0.32
95 0.31
96 0.28
97 0.25
98 0.21
99 0.18
100 0.16
101 0.15
102 0.13
103 0.12
104 0.12
105 0.09
106 0.1
107 0.11
108 0.12
109 0.12
110 0.11
111 0.11
112 0.11
113 0.16
114 0.15
115 0.16
116 0.16
117 0.2
118 0.24
119 0.27
120 0.27
121 0.24
122 0.26
123 0.29
124 0.34
125 0.37
126 0.36
127 0.34
128 0.33
129 0.31
130 0.3
131 0.33
132 0.33
133 0.31
134 0.35
135 0.4
136 0.47
137 0.52
138 0.55
139 0.54
140 0.5
141 0.51
142 0.52
143 0.46
144 0.42
145 0.38
146 0.34
147 0.28
148 0.26
149 0.2
150 0.16
151 0.17
152 0.17
153 0.15
154 0.15
155 0.16
156 0.16
157 0.18
158 0.17
159 0.15
160 0.13
161 0.14
162 0.18
163 0.17
164 0.17
165 0.2
166 0.22
167 0.26
168 0.26
169 0.3
170 0.32
171 0.39
172 0.41
173 0.37
174 0.36
175 0.33
176 0.34
177 0.37
178 0.31
179 0.25
180 0.25
181 0.26
182 0.26
183 0.29
184 0.27
185 0.2
186 0.18
187 0.17
188 0.16
189 0.14
190 0.19
191 0.15
192 0.19
193 0.2
194 0.25
195 0.27
196 0.3
197 0.3
198 0.24
199 0.25
200 0.21
201 0.24
202 0.2
203 0.17
204 0.17
205 0.17
206 0.16
207 0.15
208 0.16
209 0.13
210 0.12
211 0.11
212 0.08
213 0.08
214 0.06
215 0.06
216 0.05
217 0.04
218 0.05
219 0.05
220 0.06
221 0.1
222 0.1
223 0.1
224 0.13
225 0.18
226 0.22
227 0.29
228 0.38
229 0.44
230 0.54
231 0.62
232 0.69
233 0.74
234 0.8
235 0.85
236 0.86
237 0.84
238 0.81
239 0.82
240 0.78
241 0.73
242 0.65
243 0.57
244 0.53
245 0.49
246 0.42
247 0.39
248 0.35
249 0.33
250 0.38
251 0.38
252 0.37
253 0.37
254 0.38
255 0.34
256 0.34
257 0.35
258 0.28
259 0.3
260 0.24
261 0.21
262 0.2
263 0.2
264 0.19
265 0.17
266 0.17
267 0.17
268 0.17
269 0.17
270 0.17
271 0.21
272 0.18
273 0.18
274 0.2
275 0.17
276 0.18
277 0.17
278 0.22
279 0.18
280 0.18
281 0.18
282 0.16
283 0.2
284 0.21
285 0.26
286 0.25
287 0.3
288 0.35
289 0.38
290 0.42
291 0.45
292 0.45
293 0.43
294 0.4
295 0.41
296 0.37
297 0.41
298 0.41
299 0.38
300 0.37
301 0.35
302 0.34
303 0.36
304 0.4
305 0.39
306 0.36
307 0.34
308 0.33
309 0.34
310 0.34
311 0.26
312 0.23
313 0.19
314 0.17
315 0.17
316 0.17
317 0.15
318 0.15
319 0.14
320 0.12
321 0.11
322 0.1
323 0.07
324 0.08
325 0.12
326 0.14
327 0.15
328 0.15
329 0.14
330 0.17
331 0.2
332 0.22
333 0.17
334 0.16
335 0.16
336 0.21
337 0.23
338 0.28
339 0.32
340 0.35
341 0.36
342 0.37
343 0.4
344 0.41
345 0.49
346 0.5
347 0.49
348 0.5
349 0.52
350 0.57
351 0.57
352 0.56
353 0.5
354 0.47
355 0.47
356 0.41
357 0.38
358 0.35
359 0.32
360 0.31
361 0.3
362 0.27
363 0.22
364 0.25
365 0.29
366 0.32
367 0.38
368 0.37
369 0.4