Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6SN80

Protein Details
Accession A0A2Z6SN80    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
173-206REEERRREEERRREQERRREQERKREEERRREEEBasic
NLS Segment(s)
PositionSequence
165-209QRRQEERNREEERRREEERRREQERRREQERKREEERRREEERKR
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
Amino Acid Sequences MDFVESERFTDEQKNTLNDIRTFLGKDAKDNIIIVFTHANPDQIKFKDKMRNVWDNVPLFSSFIKDIEFRWSVSPDPYHFCDDREISEERLIEIKYLISNIREVFTTNQLEKNLREQEETKRLKEEDERRKREEYENRLKDDVIRVTRETLLAGFQEERRREEEQRRQEERNREEERRREEERRREQERRREQERKREEERRREEERKREEEQDKEDYQTIFDTAMVGAATGTFIEPGLGTLVGSGIGLAVGAGSASEDHGEIIESVMGLRHYIIIKKYISILI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.37
3 0.42
4 0.45
5 0.38
6 0.4
7 0.36
8 0.34
9 0.32
10 0.31
11 0.33
12 0.28
13 0.3
14 0.31
15 0.32
16 0.3
17 0.29
18 0.27
19 0.21
20 0.21
21 0.19
22 0.17
23 0.15
24 0.18
25 0.17
26 0.2
27 0.19
28 0.22
29 0.26
30 0.26
31 0.31
32 0.29
33 0.36
34 0.42
35 0.46
36 0.52
37 0.53
38 0.6
39 0.59
40 0.64
41 0.63
42 0.56
43 0.53
44 0.45
45 0.37
46 0.29
47 0.25
48 0.21
49 0.14
50 0.12
51 0.13
52 0.12
53 0.12
54 0.18
55 0.19
56 0.18
57 0.2
58 0.21
59 0.21
60 0.24
61 0.26
62 0.21
63 0.25
64 0.27
65 0.3
66 0.29
67 0.28
68 0.3
69 0.28
70 0.27
71 0.26
72 0.25
73 0.21
74 0.24
75 0.23
76 0.19
77 0.2
78 0.18
79 0.15
80 0.13
81 0.12
82 0.09
83 0.11
84 0.11
85 0.09
86 0.11
87 0.11
88 0.11
89 0.11
90 0.12
91 0.13
92 0.17
93 0.19
94 0.19
95 0.21
96 0.22
97 0.24
98 0.24
99 0.29
100 0.29
101 0.27
102 0.27
103 0.27
104 0.33
105 0.41
106 0.44
107 0.38
108 0.36
109 0.35
110 0.35
111 0.41
112 0.44
113 0.45
114 0.52
115 0.57
116 0.58
117 0.6
118 0.61
119 0.61
120 0.6
121 0.59
122 0.59
123 0.58
124 0.57
125 0.55
126 0.52
127 0.44
128 0.39
129 0.34
130 0.25
131 0.22
132 0.2
133 0.21
134 0.21
135 0.2
136 0.16
137 0.11
138 0.1
139 0.08
140 0.08
141 0.08
142 0.1
143 0.16
144 0.17
145 0.19
146 0.22
147 0.26
148 0.3
149 0.39
150 0.46
151 0.5
152 0.58
153 0.62
154 0.63
155 0.66
156 0.71
157 0.66
158 0.66
159 0.62
160 0.59
161 0.62
162 0.64
163 0.65
164 0.62
165 0.63
166 0.62
167 0.65
168 0.69
169 0.72
170 0.74
171 0.74
172 0.77
173 0.8
174 0.82
175 0.84
176 0.82
177 0.81
178 0.82
179 0.81
180 0.82
181 0.83
182 0.8
183 0.78
184 0.79
185 0.79
186 0.8
187 0.82
188 0.79
189 0.78
190 0.79
191 0.79
192 0.79
193 0.79
194 0.75
195 0.7
196 0.71
197 0.68
198 0.66
199 0.63
200 0.6
201 0.52
202 0.48
203 0.47
204 0.38
205 0.32
206 0.27
207 0.21
208 0.14
209 0.12
210 0.1
211 0.07
212 0.08
213 0.07
214 0.06
215 0.05
216 0.04
217 0.05
218 0.04
219 0.04
220 0.03
221 0.04
222 0.04
223 0.04
224 0.05
225 0.06
226 0.06
227 0.05
228 0.05
229 0.06
230 0.05
231 0.05
232 0.04
233 0.03
234 0.03
235 0.03
236 0.02
237 0.02
238 0.02
239 0.02
240 0.02
241 0.02
242 0.03
243 0.04
244 0.04
245 0.05
246 0.05
247 0.05
248 0.06
249 0.06
250 0.07
251 0.07
252 0.06
253 0.06
254 0.08
255 0.08
256 0.07
257 0.07
258 0.1
259 0.12
260 0.17
261 0.19
262 0.23
263 0.24
264 0.25