Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6RZ27

Protein Details
Accession A0A2Z6RZ27    Localization Confidence High Confidence Score 16.6
NoLS Segment(s)
PositionSequenceProtein Nature
46-67NIWKKELKKIKERRGKEKQSIVBasic
NLS Segment(s)
PositionSequence
49-62KKELKKIKERRGKE
Subcellular Location(s) nucl 24, cyto 1, pero 1, vacu 1, cyto_pero 1
Family & Domain DBs
Amino Acid Sequences MKEVRGREEGVIKSQDTVDKLEDTPIDEPIDHRERKNNKYQEIISNIWKKELKKIKERRGKEKQSIVMQISTLQMEEDDDTSKLTMFN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.29
3 0.23
4 0.24
5 0.2
6 0.19
7 0.19
8 0.2
9 0.19
10 0.18
11 0.18
12 0.17
13 0.15
14 0.13
15 0.13
16 0.18
17 0.25
18 0.24
19 0.25
20 0.32
21 0.39
22 0.44
23 0.54
24 0.53
25 0.49
26 0.52
27 0.53
28 0.5
29 0.48
30 0.45
31 0.42
32 0.41
33 0.38
34 0.37
35 0.37
36 0.32
37 0.36
38 0.43
39 0.42
40 0.47
41 0.57
42 0.64
43 0.71
44 0.77
45 0.78
46 0.8
47 0.83
48 0.81
49 0.79
50 0.76
51 0.72
52 0.71
53 0.63
54 0.53
55 0.44
56 0.37
57 0.3
58 0.23
59 0.17
60 0.11
61 0.09
62 0.09
63 0.1
64 0.09
65 0.1
66 0.1
67 0.11
68 0.12