Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6RWY4

Protein Details
Accession A0A2Z6RWY4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MRRHHSRVRRIKHIDERFRPPWBasic
NLS Segment(s)
Subcellular Location(s) mito 24, cyto 2
Family & Domain DBs
Amino Acid Sequences MRRHHSRVRRIKHIDERFRPPWIFLLDILKGASLSSTTLEGNFEWEGYWLEFRIRPDKSDVPALMRVAGLRGSWVEGWKGINACYE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.82
3 0.82
4 0.74
5 0.73
6 0.63
7 0.54
8 0.48
9 0.4
10 0.34
11 0.26
12 0.27
13 0.21
14 0.21
15 0.2
16 0.15
17 0.12
18 0.1
19 0.09
20 0.05
21 0.05
22 0.05
23 0.06
24 0.06
25 0.06
26 0.07
27 0.07
28 0.09
29 0.08
30 0.07
31 0.06
32 0.07
33 0.08
34 0.07
35 0.08
36 0.06
37 0.08
38 0.1
39 0.12
40 0.18
41 0.18
42 0.19
43 0.25
44 0.29
45 0.3
46 0.34
47 0.33
48 0.31
49 0.33
50 0.32
51 0.26
52 0.22
53 0.2
54 0.15
55 0.15
56 0.1
57 0.08
58 0.08
59 0.1
60 0.11
61 0.12
62 0.12
63 0.13
64 0.15
65 0.18
66 0.18