Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6S518

Protein Details
Accession A0A2Z6S518    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MCKHVKFHSNSSKKKKKKNIFRIFASEIHydrophilic
NLS Segment(s)
PositionSequence
13-18KKKKKK
Subcellular Location(s) nucl 16.5, cyto_nucl 11, mito 8
Family & Domain DBs
Amino Acid Sequences MCKHVKFHSNSSKKKKKKNIFRIFASEISQTSPYKTLRTSQTYKLHELSNFTLQNFTNSTELLNGLSSLSPQTELHLIKLHELHLTKLHELHGTHKSQDLQVSPRKLVNFANFRTSPHKNFHELHDTLTSQTTKLHKPQEPPNLTLQKLNLEAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.91
3 0.91
4 0.92
5 0.93
6 0.93
7 0.91
8 0.88
9 0.85
10 0.79
11 0.71
12 0.62
13 0.52
14 0.41
15 0.35
16 0.32
17 0.24
18 0.21
19 0.23
20 0.21
21 0.22
22 0.23
23 0.26
24 0.3
25 0.38
26 0.4
27 0.44
28 0.52
29 0.54
30 0.56
31 0.53
32 0.48
33 0.42
34 0.41
35 0.36
36 0.34
37 0.31
38 0.27
39 0.28
40 0.24
41 0.25
42 0.22
43 0.21
44 0.14
45 0.13
46 0.13
47 0.1
48 0.11
49 0.09
50 0.08
51 0.06
52 0.06
53 0.05
54 0.05
55 0.05
56 0.05
57 0.06
58 0.06
59 0.07
60 0.1
61 0.11
62 0.11
63 0.14
64 0.14
65 0.14
66 0.15
67 0.15
68 0.14
69 0.14
70 0.14
71 0.15
72 0.17
73 0.16
74 0.16
75 0.17
76 0.16
77 0.16
78 0.2
79 0.22
80 0.22
81 0.22
82 0.24
83 0.24
84 0.22
85 0.25
86 0.23
87 0.22
88 0.27
89 0.3
90 0.29
91 0.31
92 0.3
93 0.29
94 0.3
95 0.33
96 0.33
97 0.32
98 0.38
99 0.36
100 0.38
101 0.44
102 0.46
103 0.42
104 0.42
105 0.45
106 0.43
107 0.44
108 0.47
109 0.49
110 0.43
111 0.42
112 0.39
113 0.36
114 0.31
115 0.33
116 0.28
117 0.2
118 0.24
119 0.26
120 0.28
121 0.34
122 0.42
123 0.43
124 0.5
125 0.59
126 0.65
127 0.65
128 0.63
129 0.65
130 0.63
131 0.59
132 0.56
133 0.48
134 0.43