Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6Q874

Protein Details
Accession A0A2Z6Q874    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
22-41KSLNRKRKNMAQEKVLRPRSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
Amino Acid Sequences MISGKSGRIELYLRHKLEVYEKSLNRKRKNMAQEKVLRPRSWLECNVFPASPAIYVTDNGTQSINITCNHEEENNRQVMNELKVFRQHLLDYNKRTFEKXMQDIEREYREQVTANKRLRCEIEDLKMQLLEAEKELASMKGLFGTKSDSIH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.38
3 0.37
4 0.43
5 0.42
6 0.39
7 0.4
8 0.42
9 0.51
10 0.58
11 0.66
12 0.65
13 0.68
14 0.68
15 0.67
16 0.75
17 0.75
18 0.73
19 0.73
20 0.76
21 0.77
22 0.81
23 0.78
24 0.67
25 0.59
26 0.59
27 0.55
28 0.51
29 0.47
30 0.42
31 0.39
32 0.43
33 0.43
34 0.37
35 0.31
36 0.26
37 0.21
38 0.16
39 0.13
40 0.1
41 0.08
42 0.09
43 0.1
44 0.13
45 0.12
46 0.13
47 0.12
48 0.11
49 0.11
50 0.11
51 0.11
52 0.09
53 0.12
54 0.12
55 0.13
56 0.14
57 0.15
58 0.16
59 0.18
60 0.22
61 0.2
62 0.2
63 0.19
64 0.18
65 0.19
66 0.19
67 0.2
68 0.16
69 0.15
70 0.19
71 0.2
72 0.2
73 0.19
74 0.17
75 0.2
76 0.27
77 0.32
78 0.35
79 0.38
80 0.42
81 0.41
82 0.42
83 0.37
84 0.34
85 0.37
86 0.35
87 0.37
88 0.39
89 0.42
90 0.44
91 0.45
92 0.43
93 0.35
94 0.32
95 0.27
96 0.23
97 0.26
98 0.3
99 0.37
100 0.41
101 0.44
102 0.44
103 0.47
104 0.48
105 0.43
106 0.43
107 0.4
108 0.38
109 0.4
110 0.41
111 0.38
112 0.35
113 0.33
114 0.27
115 0.23
116 0.18
117 0.13
118 0.14
119 0.12
120 0.12
121 0.14
122 0.12
123 0.12
124 0.11
125 0.1
126 0.13
127 0.14
128 0.14
129 0.14
130 0.19