Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6RX19

Protein Details
Accession A0A2Z6RX19    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
184-206EMFSNPIYVKPRRRPPQKDIRVLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR007527  Znf_SWIM  
Gene Ontology GO:0008270  F:zinc ion binding  
PROSITE View protein in PROSITE  
PS50966  ZF_SWIM  
Amino Acid Sequences MIISYANVLTNVQKQLNINQKKIKILKNIVNEVLDQLVVRDFEYTPQDDALGNKYDWKKAFLKDLMKNIPNPLITEIWKVQPSIGAQPWLVQYVILLQDGSHICTCLMLINKGIICRHFIKILTKSASAFFNIPLIPSRWYNDQTAQLSGDEIHASPSIQLFNNSQSESIHITNIHTWILCVEEMFSNPIYVKPRRRPPQKDIRVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.33
3 0.43
4 0.47
5 0.49
6 0.52
7 0.54
8 0.61
9 0.66
10 0.65
11 0.64
12 0.66
13 0.66
14 0.67
15 0.68
16 0.62
17 0.56
18 0.48
19 0.4
20 0.32
21 0.24
22 0.16
23 0.11
24 0.09
25 0.09
26 0.08
27 0.09
28 0.08
29 0.11
30 0.15
31 0.16
32 0.16
33 0.16
34 0.16
35 0.15
36 0.16
37 0.17
38 0.17
39 0.15
40 0.21
41 0.22
42 0.27
43 0.27
44 0.31
45 0.32
46 0.31
47 0.38
48 0.38
49 0.44
50 0.44
51 0.51
52 0.53
53 0.51
54 0.5
55 0.44
56 0.42
57 0.34
58 0.3
59 0.25
60 0.19
61 0.18
62 0.21
63 0.2
64 0.19
65 0.2
66 0.18
67 0.16
68 0.16
69 0.16
70 0.17
71 0.17
72 0.15
73 0.14
74 0.16
75 0.16
76 0.15
77 0.13
78 0.08
79 0.07
80 0.07
81 0.08
82 0.07
83 0.06
84 0.05
85 0.09
86 0.09
87 0.11
88 0.09
89 0.09
90 0.08
91 0.08
92 0.09
93 0.07
94 0.08
95 0.07
96 0.07
97 0.09
98 0.1
99 0.11
100 0.11
101 0.1
102 0.12
103 0.14
104 0.15
105 0.16
106 0.17
107 0.21
108 0.24
109 0.29
110 0.29
111 0.27
112 0.26
113 0.26
114 0.26
115 0.21
116 0.18
117 0.13
118 0.12
119 0.11
120 0.11
121 0.11
122 0.12
123 0.13
124 0.14
125 0.16
126 0.18
127 0.21
128 0.23
129 0.24
130 0.29
131 0.29
132 0.29
133 0.27
134 0.23
135 0.21
136 0.19
137 0.16
138 0.11
139 0.09
140 0.09
141 0.08
142 0.09
143 0.09
144 0.09
145 0.11
146 0.1
147 0.13
148 0.12
149 0.16
150 0.2
151 0.2
152 0.19
153 0.17
154 0.19
155 0.22
156 0.21
157 0.19
158 0.16
159 0.17
160 0.19
161 0.2
162 0.18
163 0.14
164 0.13
165 0.12
166 0.13
167 0.11
168 0.09
169 0.09
170 0.1
171 0.11
172 0.13
173 0.13
174 0.12
175 0.13
176 0.17
177 0.22
178 0.29
179 0.38
180 0.45
181 0.56
182 0.66
183 0.76
184 0.81
185 0.85
186 0.88