Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6SAS6

Protein Details
Accession A0A2Z6SAS6    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
6-30LGWALKRNQKYGKKGSRKRLTKEVVHydrophilic
NLS Segment(s)
PositionSequence
15-24KYGKKGSRKR
Subcellular Location(s) mito 18, nucl 5, cyto 4
Family & Domain DBs
Amino Acid Sequences MFYLQLGWALKRNQKYGKKGSRKRLTKEVVATLTHFFMVGQRDPSDRYSAKDMLDGLKEMVENGEITTEVIPSQKTIEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.62
3 0.67
4 0.72
5 0.77
6 0.81
7 0.85
8 0.86
9 0.86
10 0.84
11 0.83
12 0.78
13 0.72
14 0.67
15 0.62
16 0.53
17 0.46
18 0.41
19 0.31
20 0.26
21 0.2
22 0.15
23 0.1
24 0.09
25 0.11
26 0.1
27 0.11
28 0.11
29 0.13
30 0.15
31 0.16
32 0.19
33 0.17
34 0.19
35 0.23
36 0.24
37 0.23
38 0.23
39 0.23
40 0.2
41 0.2
42 0.18
43 0.13
44 0.12
45 0.12
46 0.1
47 0.1
48 0.08
49 0.07
50 0.06
51 0.07
52 0.06
53 0.07
54 0.07
55 0.07
56 0.07
57 0.08
58 0.09
59 0.09