Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6QZV4

Protein Details
Accession A0A2Z6QZV4    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
110-131SQYTKIHPWINQRRQQRRLSIIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 12, cyto 2.5, mito 2, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR024368  Ecl1/2/3  
Pfam View protein in Pfam  
PF12855  Ecl1  
Amino Acid Sequences MDLDWCLTCSQHTSGALYCSDECRREDISYSIKVTTSPTYSFYSKPVSFPLSPSLNYRSTTKIVSGSASTSSSTSPAPSLTSQISAAILDESQSQGSSYQSSNDENVITSQYTKIHPWINQRRQQRRLSIII
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.24
3 0.23
4 0.22
5 0.21
6 0.21
7 0.24
8 0.25
9 0.24
10 0.26
11 0.28
12 0.27
13 0.28
14 0.28
15 0.29
16 0.3
17 0.31
18 0.27
19 0.24
20 0.24
21 0.24
22 0.22
23 0.2
24 0.17
25 0.19
26 0.22
27 0.24
28 0.24
29 0.24
30 0.29
31 0.26
32 0.26
33 0.26
34 0.27
35 0.25
36 0.26
37 0.29
38 0.24
39 0.24
40 0.26
41 0.27
42 0.25
43 0.26
44 0.26
45 0.24
46 0.23
47 0.23
48 0.2
49 0.18
50 0.16
51 0.15
52 0.14
53 0.11
54 0.11
55 0.11
56 0.1
57 0.09
58 0.08
59 0.09
60 0.08
61 0.08
62 0.07
63 0.07
64 0.09
65 0.09
66 0.11
67 0.1
68 0.11
69 0.11
70 0.11
71 0.11
72 0.09
73 0.09
74 0.07
75 0.06
76 0.05
77 0.06
78 0.06
79 0.06
80 0.06
81 0.06
82 0.06
83 0.08
84 0.09
85 0.09
86 0.11
87 0.13
88 0.15
89 0.16
90 0.16
91 0.16
92 0.14
93 0.15
94 0.14
95 0.13
96 0.12
97 0.13
98 0.14
99 0.16
100 0.18
101 0.22
102 0.25
103 0.29
104 0.39
105 0.49
106 0.57
107 0.63
108 0.71
109 0.77
110 0.8
111 0.84
112 0.82