Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6SN01

Protein Details
Accession A0A2Z6SN01    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
96-133QKLAEASKTARKQRKERKNRAKKFRGTKKTKASTKKEKBasic
NLS Segment(s)
PositionSequence
92-133RLVRQKLAEASKTARKQRKERKNRAKKFRGTKKTKASTKKEK
Subcellular Location(s) mito 20, nucl 3, cyto 3, cyto_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MADAGTATVRTRNFITNRLLHRRQFVVDILHPGRANVSKDELREKLATMYKSDKDTIFVFGLRTAFGGGRTTGFGLIYEDIEHAKKFEPKYRLVRQKLAEASKTARKQRKERKNRAKKFRGTKKTKASTKKEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.37
3 0.41
4 0.49
5 0.56
6 0.6
7 0.56
8 0.58
9 0.56
10 0.5
11 0.45
12 0.39
13 0.35
14 0.31
15 0.35
16 0.31
17 0.32
18 0.3
19 0.27
20 0.27
21 0.25
22 0.25
23 0.19
24 0.24
25 0.23
26 0.25
27 0.3
28 0.28
29 0.28
30 0.27
31 0.25
32 0.25
33 0.27
34 0.26
35 0.23
36 0.27
37 0.26
38 0.28
39 0.29
40 0.24
41 0.22
42 0.22
43 0.22
44 0.17
45 0.15
46 0.13
47 0.13
48 0.13
49 0.1
50 0.1
51 0.07
52 0.07
53 0.07
54 0.07
55 0.06
56 0.06
57 0.07
58 0.07
59 0.06
60 0.06
61 0.06
62 0.06
63 0.06
64 0.06
65 0.06
66 0.06
67 0.07
68 0.08
69 0.08
70 0.08
71 0.09
72 0.14
73 0.16
74 0.23
75 0.27
76 0.33
77 0.43
78 0.52
79 0.61
80 0.61
81 0.66
82 0.61
83 0.65
84 0.64
85 0.6
86 0.52
87 0.44
88 0.44
89 0.46
90 0.5
91 0.52
92 0.53
93 0.57
94 0.66
95 0.74
96 0.8
97 0.83
98 0.87
99 0.89
100 0.93
101 0.95
102 0.95
103 0.95
104 0.94
105 0.93
106 0.93
107 0.93
108 0.91
109 0.9
110 0.9
111 0.9
112 0.9
113 0.89