Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6Q162

Protein Details
Accession A0A2Z6Q162    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
8-33ILPDSNGNRRVRRKPPKLCSDCKETNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 11.5, mito 7, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MPPYVQKILPDSNGNRRVRRKPPKLCSDCKETNECVKIISNKVNKIEEIVHNFYTNLPKKNNQQFSTFNAKFALNNVPCEVEYDLSKFSLEYLHKLVISTTQNYNNGSGSNKHPSSIYSKSSAHSASSTSND
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.61
3 0.65
4 0.7
5 0.74
6 0.79
7 0.8
8 0.81
9 0.86
10 0.89
11 0.89
12 0.89
13 0.83
14 0.81
15 0.77
16 0.71
17 0.66
18 0.59
19 0.58
20 0.51
21 0.46
22 0.38
23 0.35
24 0.34
25 0.32
26 0.37
27 0.35
28 0.36
29 0.4
30 0.4
31 0.36
32 0.34
33 0.34
34 0.29
35 0.31
36 0.3
37 0.27
38 0.26
39 0.26
40 0.25
41 0.3
42 0.3
43 0.28
44 0.27
45 0.3
46 0.39
47 0.48
48 0.54
49 0.48
50 0.48
51 0.46
52 0.49
53 0.55
54 0.47
55 0.38
56 0.32
57 0.3
58 0.25
59 0.25
60 0.28
61 0.18
62 0.2
63 0.19
64 0.19
65 0.19
66 0.21
67 0.19
68 0.11
69 0.11
70 0.12
71 0.12
72 0.11
73 0.11
74 0.09
75 0.08
76 0.13
77 0.13
78 0.14
79 0.16
80 0.17
81 0.18
82 0.18
83 0.18
84 0.18
85 0.2
86 0.21
87 0.22
88 0.26
89 0.28
90 0.29
91 0.3
92 0.25
93 0.24
94 0.23
95 0.22
96 0.23
97 0.3
98 0.29
99 0.28
100 0.28
101 0.29
102 0.33
103 0.36
104 0.35
105 0.31
106 0.32
107 0.33
108 0.37
109 0.36
110 0.31
111 0.26
112 0.24