Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6S9H1

Protein Details
Accession A0A2Z6S9H1    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
46-76TLLTKFQKRSAKKKTCKKKKKTLQLQTPSGLHydrophilic
NLS Segment(s)
PositionSequence
53-66KRSAKKKTCKKKKK
Subcellular Location(s) nucl 21.5, cyto_nucl 14, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MENLRDSIYQSDISINVNEIDEDLKGLLDDESDIIPSCNNTPLYITLLTKFQKRSAKKKTCKKKKKTLQLQTPSGLNKQVVSTFSAKSLEYTPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.14
3 0.12
4 0.12
5 0.11
6 0.1
7 0.1
8 0.08
9 0.08
10 0.07
11 0.06
12 0.05
13 0.06
14 0.05
15 0.05
16 0.05
17 0.05
18 0.05
19 0.06
20 0.06
21 0.06
22 0.06
23 0.06
24 0.07
25 0.1
26 0.1
27 0.1
28 0.11
29 0.12
30 0.14
31 0.14
32 0.14
33 0.11
34 0.15
35 0.16
36 0.18
37 0.19
38 0.22
39 0.29
40 0.35
41 0.44
42 0.52
43 0.61
44 0.68
45 0.77
46 0.83
47 0.86
48 0.91
49 0.91
50 0.91
51 0.91
52 0.93
53 0.93
54 0.93
55 0.92
56 0.9
57 0.86
58 0.77
59 0.71
60 0.62
61 0.53
62 0.45
63 0.35
64 0.27
65 0.23
66 0.23
67 0.2
68 0.21
69 0.22
70 0.2
71 0.21
72 0.22
73 0.2
74 0.2