Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6QKA2

Protein Details
Accession A0A2Z6QKA2    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MPKTSLKQRNRKRVKKKPIINRTKSSSLIHydrophilic
NLS Segment(s)
PositionSequence
7-19KQRNRKRVKKKPI
Subcellular Location(s) mito 15.5, mito_nucl 12.833, nucl 9, cyto_nucl 5.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Pfam View protein in Pfam  
PF09011  HMG_box_2  
Amino Acid Sequences MPKTSLKQRNRKRVKKKPIINRTKSSSLIYFNIGVNNIETNVSRHNSNESHTDIKPSFPSTLTINELIKNSNMNNKPKLFPNAFIAYRMALIKEYRIKNLKLPSMGEVSKIARNYWNVESENVKDFYESLVKDAKLIYKQNNLQIILDKHMNNYAENKHTINFDTKKENTEHVEVQLDKEIISAASTEISLVNSSNFCTLYDRNLTLNDREYIRVLEQTIDYLLKTYVVPC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.95
2 0.95
3 0.94
4 0.94
5 0.94
6 0.94
7 0.92
8 0.89
9 0.86
10 0.81
11 0.73
12 0.66
13 0.59
14 0.52
15 0.45
16 0.39
17 0.33
18 0.28
19 0.28
20 0.24
21 0.21
22 0.17
23 0.16
24 0.13
25 0.12
26 0.12
27 0.12
28 0.16
29 0.17
30 0.17
31 0.17
32 0.22
33 0.23
34 0.24
35 0.27
36 0.27
37 0.3
38 0.3
39 0.35
40 0.3
41 0.31
42 0.31
43 0.28
44 0.25
45 0.21
46 0.22
47 0.18
48 0.21
49 0.22
50 0.22
51 0.21
52 0.22
53 0.22
54 0.21
55 0.19
56 0.18
57 0.16
58 0.22
59 0.27
60 0.31
61 0.36
62 0.38
63 0.4
64 0.43
65 0.49
66 0.42
67 0.38
68 0.38
69 0.37
70 0.35
71 0.34
72 0.29
73 0.22
74 0.21
75 0.19
76 0.14
77 0.09
78 0.09
79 0.12
80 0.19
81 0.2
82 0.24
83 0.28
84 0.29
85 0.33
86 0.38
87 0.37
88 0.31
89 0.31
90 0.28
91 0.28
92 0.27
93 0.23
94 0.19
95 0.18
96 0.18
97 0.17
98 0.16
99 0.14
100 0.15
101 0.18
102 0.18
103 0.2
104 0.19
105 0.2
106 0.21
107 0.2
108 0.22
109 0.19
110 0.18
111 0.14
112 0.13
113 0.13
114 0.15
115 0.13
116 0.12
117 0.14
118 0.14
119 0.15
120 0.15
121 0.17
122 0.18
123 0.21
124 0.23
125 0.27
126 0.3
127 0.34
128 0.37
129 0.35
130 0.31
131 0.33
132 0.3
133 0.26
134 0.27
135 0.23
136 0.19
137 0.22
138 0.22
139 0.18
140 0.21
141 0.22
142 0.22
143 0.24
144 0.24
145 0.22
146 0.22
147 0.23
148 0.27
149 0.27
150 0.27
151 0.33
152 0.33
153 0.35
154 0.36
155 0.38
156 0.34
157 0.35
158 0.33
159 0.28
160 0.31
161 0.28
162 0.27
163 0.28
164 0.23
165 0.18
166 0.17
167 0.15
168 0.1
169 0.1
170 0.09
171 0.05
172 0.06
173 0.06
174 0.06
175 0.06
176 0.07
177 0.07
178 0.07
179 0.08
180 0.08
181 0.1
182 0.11
183 0.11
184 0.11
185 0.15
186 0.16
187 0.2
188 0.25
189 0.26
190 0.26
191 0.3
192 0.32
193 0.31
194 0.34
195 0.32
196 0.29
197 0.29
198 0.29
199 0.27
200 0.26
201 0.25
202 0.22
203 0.21
204 0.2
205 0.19
206 0.2
207 0.17
208 0.15
209 0.14
210 0.13
211 0.12