Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6R2V1

Protein Details
Accession A0A2Z6R2V1    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
238-265ILIITKKKEKIVKRKKKKSNSDNEEIIRHydrophilic
NLS Segment(s)
PositionSequence
243-255KKKEKIVKRKKKK
Subcellular Location(s) nucl 13.5, cyto_nucl 9.5, mito 9, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MVKPTRSNRTNLVKNVYPRVFNPTSFSFNQLNFIKNKSEYFQYGYDLIESIQLTFCSACNSSYQRLSSKNSKSSNKSNLLKKTQDIKITKLVEIKETGETATVKVIDLEAITSSEVSTTIIQSASTSRYNDSGIENDDDAEQELEVNYKLVIKQADGVTLLTKNYSVTISELDELLLAIQNNIVVLLKDEKINANDYNVSFKLEKAQGAGTLLVDVCDFRNFRSEYIKLAAAKKIILILIITKKKEKIVKRKKKKSNSDNEEIIRDESIPKTNNNNKIPKISDISILDQRIAKNITELRKET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.71
3 0.66
4 0.58
5 0.51
6 0.53
7 0.48
8 0.42
9 0.42
10 0.37
11 0.4
12 0.38
13 0.42
14 0.37
15 0.34
16 0.41
17 0.38
18 0.37
19 0.33
20 0.35
21 0.35
22 0.33
23 0.35
24 0.3
25 0.32
26 0.31
27 0.33
28 0.32
29 0.3
30 0.28
31 0.26
32 0.24
33 0.19
34 0.16
35 0.15
36 0.13
37 0.11
38 0.11
39 0.1
40 0.11
41 0.11
42 0.11
43 0.11
44 0.12
45 0.12
46 0.16
47 0.2
48 0.23
49 0.27
50 0.29
51 0.3
52 0.34
53 0.4
54 0.45
55 0.49
56 0.53
57 0.57
58 0.62
59 0.65
60 0.69
61 0.72
62 0.72
63 0.72
64 0.71
65 0.72
66 0.72
67 0.68
68 0.64
69 0.63
70 0.58
71 0.6
72 0.54
73 0.49
74 0.5
75 0.49
76 0.46
77 0.42
78 0.37
79 0.31
80 0.3
81 0.28
82 0.21
83 0.19
84 0.17
85 0.14
86 0.14
87 0.12
88 0.12
89 0.1
90 0.09
91 0.08
92 0.08
93 0.07
94 0.06
95 0.06
96 0.05
97 0.05
98 0.05
99 0.05
100 0.05
101 0.05
102 0.05
103 0.06
104 0.06
105 0.05
106 0.06
107 0.06
108 0.06
109 0.07
110 0.08
111 0.1
112 0.12
113 0.12
114 0.12
115 0.13
116 0.14
117 0.15
118 0.15
119 0.13
120 0.13
121 0.13
122 0.12
123 0.12
124 0.11
125 0.1
126 0.09
127 0.08
128 0.06
129 0.04
130 0.04
131 0.05
132 0.04
133 0.04
134 0.04
135 0.05
136 0.05
137 0.07
138 0.07
139 0.07
140 0.1
141 0.1
142 0.11
143 0.11
144 0.11
145 0.1
146 0.1
147 0.1
148 0.07
149 0.07
150 0.06
151 0.06
152 0.06
153 0.06
154 0.06
155 0.07
156 0.08
157 0.08
158 0.08
159 0.07
160 0.07
161 0.06
162 0.06
163 0.06
164 0.05
165 0.04
166 0.04
167 0.04
168 0.04
169 0.04
170 0.04
171 0.03
172 0.05
173 0.07
174 0.08
175 0.08
176 0.09
177 0.11
178 0.13
179 0.16
180 0.15
181 0.15
182 0.17
183 0.17
184 0.21
185 0.19
186 0.21
187 0.18
188 0.18
189 0.22
190 0.21
191 0.21
192 0.17
193 0.18
194 0.15
195 0.16
196 0.17
197 0.1
198 0.09
199 0.09
200 0.07
201 0.07
202 0.06
203 0.06
204 0.09
205 0.1
206 0.09
207 0.17
208 0.18
209 0.19
210 0.25
211 0.25
212 0.25
213 0.28
214 0.32
215 0.28
216 0.3
217 0.31
218 0.26
219 0.25
220 0.22
221 0.2
222 0.16
223 0.13
224 0.1
225 0.13
226 0.21
227 0.26
228 0.27
229 0.29
230 0.31
231 0.37
232 0.44
233 0.49
234 0.52
235 0.59
236 0.68
237 0.76
238 0.86
239 0.91
240 0.94
241 0.95
242 0.95
243 0.95
244 0.92
245 0.89
246 0.86
247 0.78
248 0.71
249 0.62
250 0.52
251 0.41
252 0.33
253 0.27
254 0.22
255 0.25
256 0.24
257 0.25
258 0.34
259 0.42
260 0.51
261 0.57
262 0.63
263 0.61
264 0.66
265 0.66
266 0.61
267 0.59
268 0.51
269 0.49
270 0.44
271 0.45
272 0.44
273 0.41
274 0.38
275 0.35
276 0.34
277 0.33
278 0.31
279 0.26
280 0.26
281 0.32
282 0.38