Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6RJ13

Protein Details
Accession A0A2Z6RJ13    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
36-61EEPLETTRHNPRKRPRSATPESNDRLHydrophilic
262-288STNFATNRKKFKMKFRSKKDPHQSIVIHydrophilic
NLS Segment(s)
PositionSequence
270-280KKFKMKFRSKK
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021027  Transposase_put_HTH  
Pfam View protein in Pfam  
PF12323  HTH_OrfB_IS605  
Amino Acid Sequences MTSQSKHCNDGPIPEELLLSGCLVENDSIQLQTLYEEPLETTRHNPRKRPRSATPESNDRLQISDSITQNVKLAQGSTGNAKVLLPFWNEYTREESKKWWLPERTDCVISDSSLWDESLKKMGLNSWYSVRMSAPKVVKPSNSPHVFVQDIMEYIQPLTAEEDKLPKSKSSKIPAGKAQRIRLFPTQEEQLKLRRWIGTARWTYNQCLSVVEKEGVNRNKKDLRARCLNAVNFRNNAELKWVMKTPYDIRDEAMNDLLKGYSTNFATNRKKFKMKFRSKKDPHQSIVIHSKHWGKSRGEYSFLPKMKSAEPLPNKLEYDSRLVVNQLGEFYLCIPRPLEIRAEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.32
3 0.24
4 0.24
5 0.16
6 0.13
7 0.09
8 0.08
9 0.07
10 0.09
11 0.09
12 0.08
13 0.1
14 0.1
15 0.1
16 0.11
17 0.11
18 0.09
19 0.1
20 0.11
21 0.1
22 0.09
23 0.09
24 0.1
25 0.13
26 0.15
27 0.16
28 0.21
29 0.3
30 0.4
31 0.47
32 0.55
33 0.63
34 0.71
35 0.79
36 0.82
37 0.81
38 0.81
39 0.84
40 0.85
41 0.81
42 0.8
43 0.74
44 0.69
45 0.62
46 0.53
47 0.45
48 0.36
49 0.31
50 0.25
51 0.27
52 0.24
53 0.25
54 0.25
55 0.24
56 0.23
57 0.22
58 0.2
59 0.14
60 0.14
61 0.12
62 0.12
63 0.13
64 0.16
65 0.17
66 0.16
67 0.15
68 0.15
69 0.14
70 0.13
71 0.16
72 0.14
73 0.14
74 0.16
75 0.21
76 0.22
77 0.23
78 0.29
79 0.31
80 0.33
81 0.33
82 0.34
83 0.38
84 0.44
85 0.46
86 0.48
87 0.48
88 0.5
89 0.57
90 0.61
91 0.56
92 0.51
93 0.47
94 0.42
95 0.37
96 0.31
97 0.24
98 0.17
99 0.14
100 0.13
101 0.13
102 0.1
103 0.1
104 0.11
105 0.14
106 0.13
107 0.12
108 0.12
109 0.15
110 0.18
111 0.19
112 0.2
113 0.19
114 0.2
115 0.2
116 0.21
117 0.19
118 0.18
119 0.18
120 0.22
121 0.23
122 0.23
123 0.28
124 0.29
125 0.3
126 0.3
127 0.34
128 0.38
129 0.37
130 0.36
131 0.33
132 0.34
133 0.32
134 0.28
135 0.24
136 0.14
137 0.13
138 0.11
139 0.1
140 0.07
141 0.07
142 0.07
143 0.06
144 0.05
145 0.07
146 0.08
147 0.08
148 0.09
149 0.12
150 0.13
151 0.16
152 0.17
153 0.17
154 0.19
155 0.26
156 0.33
157 0.35
158 0.42
159 0.43
160 0.47
161 0.52
162 0.57
163 0.57
164 0.54
165 0.54
166 0.52
167 0.49
168 0.49
169 0.47
170 0.41
171 0.35
172 0.33
173 0.32
174 0.29
175 0.29
176 0.27
177 0.27
178 0.27
179 0.28
180 0.28
181 0.24
182 0.23
183 0.25
184 0.27
185 0.3
186 0.32
187 0.33
188 0.36
189 0.36
190 0.37
191 0.37
192 0.35
193 0.26
194 0.23
195 0.21
196 0.18
197 0.19
198 0.18
199 0.15
200 0.15
201 0.23
202 0.28
203 0.33
204 0.32
205 0.35
206 0.4
207 0.44
208 0.52
209 0.52
210 0.53
211 0.56
212 0.58
213 0.58
214 0.6
215 0.59
216 0.57
217 0.55
218 0.51
219 0.43
220 0.41
221 0.39
222 0.33
223 0.29
224 0.25
225 0.23
226 0.2
227 0.21
228 0.22
229 0.19
230 0.2
231 0.23
232 0.23
233 0.27
234 0.3
235 0.28
236 0.27
237 0.3
238 0.3
239 0.28
240 0.28
241 0.21
242 0.17
243 0.17
244 0.16
245 0.12
246 0.11
247 0.11
248 0.11
249 0.11
250 0.16
251 0.18
252 0.28
253 0.37
254 0.44
255 0.52
256 0.54
257 0.63
258 0.64
259 0.72
260 0.74
261 0.77
262 0.8
263 0.81
264 0.86
265 0.86
266 0.91
267 0.91
268 0.89
269 0.81
270 0.79
271 0.7
272 0.66
273 0.68
274 0.58
275 0.48
276 0.43
277 0.47
278 0.44
279 0.49
280 0.49
281 0.42
282 0.49
283 0.56
284 0.56
285 0.53
286 0.5
287 0.51
288 0.53
289 0.52
290 0.46
291 0.4
292 0.4
293 0.37
294 0.41
295 0.38
296 0.39
297 0.43
298 0.48
299 0.49
300 0.51
301 0.5
302 0.46
303 0.46
304 0.38
305 0.38
306 0.34
307 0.32
308 0.28
309 0.28
310 0.28
311 0.25
312 0.23
313 0.17
314 0.15
315 0.14
316 0.13
317 0.14
318 0.18
319 0.17
320 0.18
321 0.17
322 0.19
323 0.21
324 0.23