Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6SF76

Protein Details
Accession A0A2Z6SF76    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
84-115NESQNKKRKIKIKDPLKCKRKVEEVKRNLYHLHydrophilic
NLS Segment(s)
PositionSequence
89-104KKRKIKIKDPLKCKRK
Subcellular Location(s) nucl 18.5, cyto_nucl 13.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012337  RNaseH-like_sf  
Amino Acid Sequences MLIDDEWKLMQQLTKLLQPFYDTTKLLSGEKYATVSFIYYVVASLQVKVIPKEIEMVDLTNDDNALTIDDIEFEDGNDDDVVMNESQNKKRKIKIKDPLKCKRKVEEVKRNLYHLLLH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.26
3 0.25
4 0.24
5 0.25
6 0.25
7 0.26
8 0.27
9 0.23
10 0.22
11 0.25
12 0.26
13 0.24
14 0.23
15 0.19
16 0.16
17 0.17
18 0.17
19 0.13
20 0.12
21 0.12
22 0.11
23 0.1
24 0.08
25 0.08
26 0.06
27 0.06
28 0.05
29 0.08
30 0.07
31 0.07
32 0.07
33 0.09
34 0.1
35 0.1
36 0.12
37 0.1
38 0.1
39 0.12
40 0.11
41 0.11
42 0.11
43 0.11
44 0.09
45 0.09
46 0.09
47 0.07
48 0.06
49 0.05
50 0.04
51 0.04
52 0.04
53 0.04
54 0.04
55 0.04
56 0.04
57 0.04
58 0.05
59 0.05
60 0.04
61 0.05
62 0.05
63 0.06
64 0.06
65 0.06
66 0.05
67 0.05
68 0.07
69 0.06
70 0.07
71 0.11
72 0.16
73 0.24
74 0.32
75 0.39
76 0.42
77 0.49
78 0.57
79 0.62
80 0.68
81 0.71
82 0.74
83 0.77
84 0.83
85 0.86
86 0.87
87 0.86
88 0.81
89 0.78
90 0.78
91 0.8
92 0.8
93 0.81
94 0.81
95 0.83
96 0.81
97 0.76
98 0.67