Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6RRA1

Protein Details
Accession A0A2Z6RRA1    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
39-64MPLTKSQKRSAKKKACKEKQKLQLQTHydrophilic
NLS Segment(s)
PositionSequence
47-52RSAKKK
Subcellular Location(s) nucl 15.5, cyto_nucl 14.833, cyto 9, cyto_pero 5.665
Family & Domain DBs
Amino Acid Sequences MHQSDALMNFDVFNTNSIESLDDDLIATPSYNTTPIPVMPLTKSQKRSAKKKACKEKQKLQLQTPSGLDEQVVPTFSTISPEYTLSKPSDSRMVTFNQSLLSPPFTPYK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.11
3 0.12
4 0.12
5 0.13
6 0.11
7 0.14
8 0.12
9 0.1
10 0.1
11 0.1
12 0.1
13 0.09
14 0.08
15 0.06
16 0.06
17 0.07
18 0.08
19 0.07
20 0.08
21 0.09
22 0.09
23 0.12
24 0.11
25 0.12
26 0.13
27 0.21
28 0.25
29 0.3
30 0.34
31 0.38
32 0.46
33 0.52
34 0.6
35 0.63
36 0.68
37 0.72
38 0.78
39 0.82
40 0.85
41 0.87
42 0.86
43 0.85
44 0.84
45 0.84
46 0.8
47 0.74
48 0.72
49 0.63
50 0.57
51 0.48
52 0.41
53 0.32
54 0.26
55 0.2
56 0.13
57 0.13
58 0.11
59 0.11
60 0.08
61 0.08
62 0.09
63 0.09
64 0.12
65 0.11
66 0.12
67 0.12
68 0.14
69 0.17
70 0.17
71 0.2
72 0.19
73 0.21
74 0.21
75 0.22
76 0.28
77 0.26
78 0.27
79 0.27
80 0.29
81 0.3
82 0.3
83 0.29
84 0.22
85 0.21
86 0.22
87 0.22
88 0.23
89 0.19