Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6SA97

Protein Details
Accession A0A2Z6SA97    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
53-78GFPNTNSRRANRHNKRNNNNNSDNSSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto 6, mito 2
Family & Domain DBs
Amino Acid Sequences MVIPDEVPPLLAALLPRNPRPKYSIYSDSIKWIVFLSKMSSRTSQNVARRGGGFPNTNSRRANRHNKRNNNNNSDNSSSDGESAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.21
3 0.26
4 0.34
5 0.35
6 0.37
7 0.41
8 0.42
9 0.41
10 0.44
11 0.46
12 0.42
13 0.45
14 0.43
15 0.42
16 0.39
17 0.33
18 0.26
19 0.2
20 0.16
21 0.12
22 0.12
23 0.12
24 0.15
25 0.17
26 0.18
27 0.2
28 0.21
29 0.23
30 0.27
31 0.29
32 0.31
33 0.35
34 0.35
35 0.34
36 0.34
37 0.33
38 0.31
39 0.29
40 0.25
41 0.21
42 0.3
43 0.32
44 0.35
45 0.36
46 0.36
47 0.4
48 0.47
49 0.57
50 0.57
51 0.65
52 0.72
53 0.8
54 0.88
55 0.9
56 0.91
57 0.9
58 0.87
59 0.81
60 0.77
61 0.71
62 0.62
63 0.55
64 0.48
65 0.39