Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6RXN9

Protein Details
Accession A0A2Z6RXN9    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
56-77EYKELRKKNADKAKENRKKVEEBasic
NLS Segment(s)
PositionSequence
61-74RKKNADKAKENRKK
Subcellular Location(s) nucl 15, cyto_nucl 10.5, mito 8, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013892  Cyt_c_biogenesis_Cmc1-like  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
Pfam View protein in Pfam  
PF08583  Cmc1  
Amino Acid Sequences MLFFVTMHPNLAYHKHPKCLDVILRLEECHKSGFFNKYFGSCNEIKKELNECLTLEYKELRKKNADKAKENRKKVEELWKEFNL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.39
3 0.4
4 0.41
5 0.41
6 0.44
7 0.42
8 0.39
9 0.38
10 0.34
11 0.34
12 0.33
13 0.32
14 0.27
15 0.24
16 0.19
17 0.16
18 0.14
19 0.17
20 0.24
21 0.22
22 0.24
23 0.24
24 0.24
25 0.26
26 0.24
27 0.25
28 0.21
29 0.23
30 0.24
31 0.25
32 0.24
33 0.24
34 0.27
35 0.24
36 0.23
37 0.21
38 0.18
39 0.19
40 0.21
41 0.19
42 0.17
43 0.19
44 0.22
45 0.28
46 0.31
47 0.32
48 0.38
49 0.43
50 0.53
51 0.59
52 0.62
53 0.64
54 0.71
55 0.79
56 0.8
57 0.83
58 0.81
59 0.76
60 0.73
61 0.7
62 0.71
63 0.69
64 0.67