Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6Q3X5

Protein Details
Accession A0A2Z6Q3X5    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
166-194WEQTKGIKKQEKKRRLSSHKYIKYNRTLTHydrophilic
NLS Segment(s)
PositionSequence
173-180KKQEKKRR
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 3
Family & Domain DBs
Amino Acid Sequences MIPMLTLLPTLEIMKERRYDLYRDAKCRFCLTENEDEDHIIYCQQLKDKWITIANNTVHQYDQVLTNFITQEKQIQIQLNQKDIQQLHLWNRNFFKHTIGINYELPISFVHLLLRNFFPKGKYKELKNIVKSKKIALTIATLYLEVFTNEFHNIIWQPCCKIIAEWEQTKGIKKQEKKRRLSSHKYIKYNRTLTTQIEEDTYDLKGRKILKHNEQWSIALEKSRQYINKQIRERNKVAWKRVVKAYTEAICYNDPI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.24
3 0.26
4 0.31
5 0.34
6 0.37
7 0.41
8 0.49
9 0.52
10 0.57
11 0.61
12 0.6
13 0.6
14 0.6
15 0.55
16 0.47
17 0.48
18 0.46
19 0.5
20 0.48
21 0.48
22 0.44
23 0.4
24 0.38
25 0.3
26 0.24
27 0.15
28 0.12
29 0.12
30 0.13
31 0.17
32 0.18
33 0.2
34 0.24
35 0.26
36 0.29
37 0.32
38 0.31
39 0.3
40 0.37
41 0.35
42 0.36
43 0.35
44 0.33
45 0.27
46 0.25
47 0.24
48 0.17
49 0.19
50 0.14
51 0.15
52 0.14
53 0.15
54 0.16
55 0.15
56 0.15
57 0.11
58 0.15
59 0.14
60 0.16
61 0.18
62 0.2
63 0.24
64 0.31
65 0.33
66 0.33
67 0.32
68 0.31
69 0.33
70 0.31
71 0.29
72 0.24
73 0.26
74 0.29
75 0.36
76 0.36
77 0.35
78 0.37
79 0.37
80 0.37
81 0.33
82 0.3
83 0.26
84 0.25
85 0.25
86 0.24
87 0.25
88 0.23
89 0.22
90 0.2
91 0.16
92 0.15
93 0.12
94 0.11
95 0.08
96 0.08
97 0.09
98 0.12
99 0.12
100 0.14
101 0.15
102 0.14
103 0.15
104 0.16
105 0.17
106 0.22
107 0.26
108 0.34
109 0.36
110 0.38
111 0.46
112 0.54
113 0.59
114 0.58
115 0.62
116 0.57
117 0.59
118 0.57
119 0.51
120 0.46
121 0.4
122 0.34
123 0.25
124 0.24
125 0.18
126 0.18
127 0.15
128 0.11
129 0.1
130 0.09
131 0.08
132 0.06
133 0.05
134 0.05
135 0.06
136 0.06
137 0.06
138 0.06
139 0.08
140 0.09
141 0.11
142 0.13
143 0.13
144 0.14
145 0.15
146 0.16
147 0.14
148 0.13
149 0.16
150 0.21
151 0.26
152 0.27
153 0.28
154 0.3
155 0.31
156 0.34
157 0.34
158 0.33
159 0.35
160 0.42
161 0.5
162 0.58
163 0.67
164 0.72
165 0.79
166 0.83
167 0.85
168 0.86
169 0.87
170 0.87
171 0.86
172 0.87
173 0.84
174 0.81
175 0.8
176 0.75
177 0.67
178 0.61
179 0.55
180 0.48
181 0.45
182 0.39
183 0.3
184 0.26
185 0.24
186 0.19
187 0.17
188 0.16
189 0.15
190 0.14
191 0.14
192 0.17
193 0.22
194 0.28
195 0.36
196 0.45
197 0.51
198 0.6
199 0.66
200 0.68
201 0.65
202 0.59
203 0.53
204 0.48
205 0.39
206 0.33
207 0.28
208 0.25
209 0.26
210 0.3
211 0.31
212 0.32
213 0.41
214 0.47
215 0.55
216 0.61
217 0.68
218 0.72
219 0.78
220 0.77
221 0.77
222 0.77
223 0.76
224 0.76
225 0.76
226 0.72
227 0.7
228 0.74
229 0.69
230 0.61
231 0.57
232 0.57
233 0.51
234 0.49
235 0.44
236 0.39