Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6RW27

Protein Details
Accession A0A2Z6RW27    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-36MTIKSCLKCRFKKNFFKCCNKCKLKHFKLNYGKSPSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21.5, mito_nucl 13.833, nucl 5
Family & Domain DBs
Amino Acid Sequences MTIKSCLKCRFKKNFFKCCNKCKLKHFKLNYGKSPSGNNEIDKIFRDNYCESNSSKELIEWIPYNEFKNIACIGIEKVPSKYYIARYRKVNITVILMKFENLGRSQAPPSMG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.89
3 0.91
4 0.9
5 0.89
6 0.89
7 0.88
8 0.84
9 0.84
10 0.86
11 0.84
12 0.85
13 0.82
14 0.82
15 0.83
16 0.84
17 0.81
18 0.78
19 0.7
20 0.61
21 0.58
22 0.51
23 0.48
24 0.42
25 0.34
26 0.29
27 0.27
28 0.27
29 0.25
30 0.24
31 0.19
32 0.17
33 0.2
34 0.19
35 0.21
36 0.22
37 0.22
38 0.2
39 0.23
40 0.24
41 0.21
42 0.19
43 0.16
44 0.15
45 0.13
46 0.14
47 0.1
48 0.11
49 0.13
50 0.14
51 0.15
52 0.14
53 0.14
54 0.12
55 0.15
56 0.14
57 0.11
58 0.1
59 0.1
60 0.11
61 0.14
62 0.16
63 0.14
64 0.15
65 0.16
66 0.17
67 0.18
68 0.2
69 0.25
70 0.33
71 0.39
72 0.43
73 0.47
74 0.52
75 0.56
76 0.56
77 0.52
78 0.43
79 0.43
80 0.44
81 0.4
82 0.38
83 0.32
84 0.28
85 0.26
86 0.25
87 0.22
88 0.17
89 0.19
90 0.17
91 0.2
92 0.22