Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6QHT5

Protein Details
Accession A0A2Z6QHT5    Localization Confidence High Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
19-46IPELRKKLAKIPKLRKKLAKVKARNAELHydrophilic
NLS Segment(s)
PositionSequence
22-43LRKKLAKIPKLRKKLAKVKARN
Subcellular Location(s) nucl 21, mito 6
Family & Domain DBs
Amino Acid Sequences MKNRIGRRNAKLETENAEIPELRKKLAKIPKLRKKLAKVKARNAELIKEMMKEDNRHVARIKLLKAIEEKYTRRAEFEVKIEELEKNRTDIVAENTELRSRVVKLEQDIVELKKELEPKKNHKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.46
3 0.37
4 0.35
5 0.28
6 0.26
7 0.3
8 0.25
9 0.22
10 0.24
11 0.24
12 0.31
13 0.4
14 0.47
15 0.5
16 0.6
17 0.69
18 0.75
19 0.82
20 0.81
21 0.81
22 0.83
23 0.81
24 0.81
25 0.79
26 0.8
27 0.81
28 0.75
29 0.72
30 0.63
31 0.56
32 0.47
33 0.4
34 0.31
35 0.23
36 0.21
37 0.18
38 0.19
39 0.18
40 0.18
41 0.25
42 0.25
43 0.26
44 0.26
45 0.24
46 0.26
47 0.28
48 0.28
49 0.23
50 0.22
51 0.23
52 0.25
53 0.25
54 0.25
55 0.26
56 0.26
57 0.28
58 0.33
59 0.31
60 0.3
61 0.3
62 0.29
63 0.27
64 0.3
65 0.27
66 0.23
67 0.23
68 0.23
69 0.24
70 0.22
71 0.23
72 0.2
73 0.18
74 0.17
75 0.17
76 0.17
77 0.17
78 0.2
79 0.19
80 0.19
81 0.19
82 0.21
83 0.22
84 0.22
85 0.2
86 0.17
87 0.15
88 0.18
89 0.2
90 0.23
91 0.24
92 0.31
93 0.31
94 0.32
95 0.34
96 0.32
97 0.3
98 0.27
99 0.26
100 0.22
101 0.29
102 0.32
103 0.38
104 0.46